Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00032
         (558 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450 monoo...    22   3.7  
X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.    22   4.8  
EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2 prot...    22   4.8  
AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2 prot...    22   4.8  
DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride c...    21   8.4  
DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride c...    21   8.4  
AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    21   8.4  
AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl sub...    21   8.4  

>DQ232888-1|ABB36783.1|  499|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 499

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 11/36 (30%), Positives = 15/36 (41%)
 Frame = +1

Query: 298 LEMYCPHHCQMWKLVPAHTLNMLHILVTTA*YTWVP 405
           L MY P    M K +  +T N   I +      W+P
Sbjct: 364 LRMYPPASILMRKAISDYTFNDTKITIPKEMKIWIP 399


>X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.
          Length = 162

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -1

Query: 402 YPGILGCGH 376
           YPG L CGH
Sbjct: 31  YPGTLWCGH 39


>EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -1

Query: 402 YPGILGCGH 376
           YPG L CGH
Sbjct: 36  YPGTLWCGH 44


>AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -1

Query: 402 YPGILGCGH 376
           YPG L CGH
Sbjct: 36  YPGTLWCGH 44


>DQ667182-1|ABG75734.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = +2

Query: 386 PNIPGYHGSH 415
           P +PG HG H
Sbjct: 335 PGVPGDHGDH 344


>DQ667181-1|ABG75733.1|  445|Apis mellifera GABA-gated chloride
           channel protein.
          Length = 445

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = +2

Query: 386 PNIPGYHGSH 415
           P +PG HG H
Sbjct: 335 PGVPGDHGDH 344


>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 8/22 (36%), Positives = 13/22 (59%)
 Frame = +1

Query: 43  ELTLEHFTTKAMLRFHPKLGSE 108
           E+ LEH   +A    HP+L ++
Sbjct: 149 EMLLEHKKRRARRDIHPELNTQ 170


>AF094822-1|AAC63381.1|  365|Apis mellifera GABA receptor Rdl
           subunit protein.
          Length = 365

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = +2

Query: 386 PNIPGYHGSH 415
           P +PG HG H
Sbjct: 274 PGVPGDHGDH 283


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,514
Number of Sequences: 438
Number of extensions: 3688
Number of successful extensions: 12
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16072521
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)