BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00028 (470 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4B4.02c |nca2||mitochondrial protein Nca2 |Schizosaccharomyc... 25 4.4 SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyce... 25 5.8 SPCC1795.08c |||histone acetyltransferase complex subunit |Schiz... 25 7.7 >SPBC4B4.02c |nca2||mitochondrial protein Nca2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 573 Score = 25.4 bits (53), Expect = 4.4 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -1 Query: 374 KSKIAIHPVLLTLPILSKSRQLSTRLLVQ*LTLKFCTVSIQAHKKNKFNTD 222 K+K+ + L + L KS++L + +L FC V I+ K N FN D Sbjct: 428 KTKVDVEVALSGIDRLLKSQELVFATVGITPSLIFCYVIIRYVKANIFNND 478 >SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 2104 Score = 25.0 bits (52), Expect = 5.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 359 LRSLTFIRYVDNNGILKNRLSH 424 L SL RYVD+ LKN L H Sbjct: 295 LESLFLDRYVDHYSYLKNGLKH 316 >SPCC1795.08c |||histone acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 985 Score = 24.6 bits (51), Expect = 7.7 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 391 VNVTNESQRSQSILFFLHCQF 329 + +T E +LF+LHC+F Sbjct: 45 IKLTKEKHEKLLLLFWLHCKF 65 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,915,325 Number of Sequences: 5004 Number of extensions: 36452 Number of successful extensions: 82 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 180421690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -