BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00028 (470 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04360.1 68417.m00623 hypothetical protein 27 4.8 At1g67190.1 68414.m07643 F-box family protein 27 4.8 At3g18650.1 68416.m02369 MADS-box family protein contains simila... 27 8.5 >At4g04360.1 68417.m00623 hypothetical protein Length = 125 Score = 27.5 bits (58), Expect = 4.8 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 Query: 105 RKTLKIQFGWLLYHCR 152 R+ + FGW+L+HC+ Sbjct: 4 RRRFHVHFGWILFHCQ 19 >At1g67190.1 68414.m07643 F-box family protein Length = 419 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 171 NSSHMVFYNDITTNRIESL 115 NS+ FY D+TTNR+E L Sbjct: 46 NSADWPFYRDLTTNRLEIL 64 >At3g18650.1 68416.m02369 MADS-box family protein contains similarity to hypothetical proteins of [Arabidopsis thaliana] Length = 386 Score = 26.6 bits (56), Expect = 8.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 353 DGLRSLTFIRYVDNNGILKNRLSHW*FSFLTF 448 +GL+S+ Y +NN I N LSH F T+ Sbjct: 334 NGLQSMNMHDYSNNNSINSNGLSHQYVQFPTY 365 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,441,477 Number of Sequences: 28952 Number of extensions: 171233 Number of successful extensions: 295 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -