BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00027 (778 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36468| Best HMM Match : DUF1643 (HMM E-Value=4.1) 29 5.5 SB_25436| Best HMM Match : 7tm_1 (HMM E-Value=9.49996e-41) 29 5.5 SB_14555| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_57726| Best HMM Match : YiaAB (HMM E-Value=0.56) 29 5.5 SB_911| Best HMM Match : bZIP_1 (HMM E-Value=0.53) 29 5.5 SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 >SB_36468| Best HMM Match : DUF1643 (HMM E-Value=4.1) Length = 471 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -3 Query: 185 VKVVETHPIWYSTMI*QPT 129 +K++E P WYSTM+ +PT Sbjct: 313 LKLIEATPPWYSTMVPKPT 331 >SB_25436| Best HMM Match : 7tm_1 (HMM E-Value=9.49996e-41) Length = 321 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -2 Query: 369 KDRNPSCSSYIANFI*IKTTKYTFV-SAMINPQVLYGIHSGSQKK 238 +DR Y ++I +KT ++T V S+ INP +LYG S + ++ Sbjct: 251 QDRVIIIQKYDIHYIVLKTVEFTLVCSSCINP-ILYGFQSSNYRE 294 >SB_14555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -3 Query: 185 VKVVETHPIWYSTMI*QPT 129 +K++E P WYSTM+ +PT Sbjct: 40 LKLIEATPPWYSTMVPKPT 58 >SB_57726| Best HMM Match : YiaAB (HMM E-Value=0.56) Length = 400 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -3 Query: 185 VKVVETHPIWYSTMI*QPT 129 +K++E P WYSTM+ +PT Sbjct: 252 LKLIEATPPWYSTMVPKPT 270 >SB_911| Best HMM Match : bZIP_1 (HMM E-Value=0.53) Length = 260 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -3 Query: 185 VKVVETHPIWYSTMI*QPT 129 +K++E P WYSTM+ +PT Sbjct: 127 LKLIEATPPWYSTMVPKPT 145 >SB_2637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 28.3 bits (60), Expect = 7.3 Identities = 45/184 (24%), Positives = 76/184 (41%), Gaps = 8/184 (4%) Frame = -3 Query: 707 ISPLHSRCLFLKDISVNTLLWFVGNQL-SVTTRFKTSNHEETRHY*SAKGWKKTHFKIPG 531 +SP S +L DI V F+G+ + + F + +++ + WK FK+ G Sbjct: 33 VSPDPSPVCWLPDIVVG----FLGSVFYQIQSLFGHLMDSKLQYFAPEQFWKC--FKLWG 86 Query: 530 QP*HKRTKY----LFC*LIQVLC*Y-KISRPHKMLKKKITSVIIDFLGCHYCQRNE*KSK 366 QP + R + FC L L + K + ++ KK + D C C + + Sbjct: 87 QPVNVREQQDAFEFFCNLTDQLDEHLKSKKQDQLFKKTFCGMFADQKICKECNHRYEREE 146 Query: 365 IAIHPVLLTLPILSKSRQLSTRL--LVQ*LTLKFCTVYIQAHKKNKFNTDQRGSVNEYRF 192 +LP+ K+ L L V L+ Y K NK T +G++N+Y Sbjct: 147 -----AFYSLPVTVKNHNLQDSLEQFVNGEILEGDNAYF-CEKCNKRMT-LKGNINQYNN 199 Query: 191 ICVK 180 +C+K Sbjct: 200 VCLK 203 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,168,769 Number of Sequences: 59808 Number of extensions: 426179 Number of successful extensions: 684 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -