BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00026 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 25 0.59 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 24 1.0 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 24 1.4 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 1.8 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 25.0 bits (52), Expect = 0.59 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -1 Query: 382 LANILSLVALKLQHLAVLRVLHDRTLHANSFL 287 L +I VAL ++HLA RV+H R L A + L Sbjct: 594 LLSIARQVALGMEHLAKTRVVH-RDLAARNVL 624 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 446 LLKHNMSTLNIVL*EIARCNYNPIKNM 526 LLKHN+ L+ ++ I Y PIK + Sbjct: 115 LLKHNLFLLDNIVKPIIAFYYKPIKTL 141 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 567 GC-PRPVPCDFLCCIKYCKSYILSPPSRL 650 GC P+P+P CI C SYI S++ Sbjct: 54 GCVPKPIPS--FACIGRCASYIQVSGSKI 80 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = +1 Query: 556 KENTVVRDLCLATSSVV*NIVNLIYYRRRLVS*VAK 663 K + LC+ T+ V + +++IYYR+ + + +++ Sbjct: 25 KTRAKIYALCVVTALVTPSALSIIYYRQPIYAKISE 60 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 512 PIKNMYLESTDVYR 553 PI N Y E+ VYR Sbjct: 773 PIPNKYYEAKQVYR 786 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,408 Number of Sequences: 336 Number of extensions: 3241 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -