BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00025 (774 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.2 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 4.2 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -3 Query: 640 AAIIYKIYNILYNRGSRKAQGADNRVLFSL*TSVLSKYI 524 +++I + N+ +RGS G +N + + T+ SKY+ Sbjct: 173 SSVIEEAQNLKMSRGSSVVTGMNNIETYIVNTNYSSKYM 211 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 162 AFDSIGEWVECVEILDGHTIER 97 A SI E+ E+L HT+E+ Sbjct: 259 AMSSIAEFSVSTEVLQDHTLEK 280 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,022 Number of Sequences: 438 Number of extensions: 4420 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -