BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00023 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0245 - 27841761-27841884,27841920-27842128 29 2.6 09_06_0198 - 21496692-21496991,21497111-21497258,21497341-214975... 29 4.5 >01_06_0245 - 27841761-27841884,27841920-27842128 Length = 110 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/56 (30%), Positives = 21/56 (37%) Frame = -3 Query: 371 SYLSAPNVITDPPDPLTVLLGTTSTGHXXXXXXXXXXRADE*INPQTQPTEFLAGP 204 S +P+ DP DP VL +TS A P + P FL GP Sbjct: 39 SSFESPDASFDPEDPTCVLSSSTSADRISVLPLGRRCPAGGVEGPTSSPAAFLLGP 94 >09_06_0198 - 21496692-21496991,21497111-21497258,21497341-21497578, 21497679-21497889,21497977-21498170,21498263-21498364, 21498525-21499879,21501193-21501494,21501600-21501750, 21501838-21502102,21502155-21502362,21502467-21502660, 21502749-21502850,21503481-21503680,21504010-21504846, 21505806-21506107,21506209-21506359,21506447-21506684, 21506764-21506971,21507078-21507271,21507322-21507462, 21513484-21514811,21515923-21516227,21516331-21516481, 21516570-21516807,21516881-21517088,21517197-21517366, 21517451-21517549,21517708-21519029,21521601-21521683 Length = 3314 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 423 CSEPSLLCLHKSHDNRPASTS---TIAGPRSVGGRPAPS 530 C +LLC+ +S D+RP +S T+ SV PAPS Sbjct: 787 CIHVALLCVQESPDDRPLMSSIVFTLENGSSVALLPAPS 825 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,393,630 Number of Sequences: 37544 Number of extensions: 392897 Number of successful extensions: 1088 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1088 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -