BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00023 (679 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL138972-8|CAB72291.1| 222|Drosophila melanogaster EG:BACR25B3.... 32 0.63 AE014298-413|AAF45790.2| 222|Drosophila melanogaster CG13760-PB... 32 0.63 BT029287-1|ABK30924.1| 587|Drosophila melanogaster RT01119p pro... 31 1.4 AE014297-842|AAF54310.1| 587|Drosophila melanogaster CG11966-PA... 31 1.4 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 31 1.9 >AL138972-8|CAB72291.1| 222|Drosophila melanogaster EG:BACR25B3.6 protein. Length = 222 Score = 32.3 bits (70), Expect = 0.63 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -1 Query: 499 GPAIVLVDAGLLSCDLCKHNKL 434 GP I+L +A LL+C++CK N L Sbjct: 135 GPVILLTNASLLTCEVCKRNVL 156 >AE014298-413|AAF45790.2| 222|Drosophila melanogaster CG13760-PB protein. Length = 222 Score = 32.3 bits (70), Expect = 0.63 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -1 Query: 499 GPAIVLVDAGLLSCDLCKHNKL 434 GP I+L +A LL+C++CK N L Sbjct: 135 GPVILLTNASLLTCEVCKRNVL 156 >BT029287-1|ABK30924.1| 587|Drosophila melanogaster RT01119p protein. Length = 587 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +3 Query: 54 YADSDSLEKLYQLLVDVLTHGAQTRSVANTSPSKSSASQNLPLDRKRDSLRS 209 +ADS KLY + + +G+ + S AN + S S + P+D+ DSL + Sbjct: 179 FADSQLDSKLYSVADSCVMNGSGSGSAANGNGSGPSIATLTPIDQVADSLHN 230 >AE014297-842|AAF54310.1| 587|Drosophila melanogaster CG11966-PA protein. Length = 587 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +3 Query: 54 YADSDSLEKLYQLLVDVLTHGAQTRSVANTSPSKSSASQNLPLDRKRDSLRS 209 +ADS KLY + + +G+ + S AN + S S + P+D+ DSL + Sbjct: 179 FADSQLDSKLYSVADSCVMNGSGSGSAANGNGSGPSIATLTPIDQVADSLHN 230 >AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA protein. Length = 1027 Score = 30.7 bits (66), Expect = 1.9 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = +3 Query: 15 PRRLRTAEFFFSTYADSDSLEKLYQLLVDVLTHGAQTRSVANT-SPSKSSASQNLPLDRK 191 P L+ + F S+ +S + ++ L V H + T + + T S S +S + +PL +K Sbjct: 200 PNALQRLKLFGSSSRESGTTRRI---LGGVNGHSSTTMATSTTASASATSTTTRVPLYKK 256 Query: 192 RDSLRSGEKLSGL 230 R LRS K GL Sbjct: 257 RQHLRSTLKPPGL 269 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,697,450 Number of Sequences: 53049 Number of extensions: 661100 Number of successful extensions: 1696 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1696 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2951284050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -