BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00023 (679 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 8.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 8.2 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = -2 Query: 642 T*SSYLLSFVIQDTQRVYSRFRDALDSGVQ 553 T +S + S ++ DT++ + + RD+L V+ Sbjct: 711 TRNSEMFSSLLSDTEQHFRQHRDSLSPRVE 740 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 495 GPRSVGGRPAPS*RQ----IARQPVHPSRGRHENDCKPVVYP 608 GP + GGRP P + + P RGR+++ + P Sbjct: 1356 GPSASGGRPVPERPERVPTVDLSPSPSDRGRNDDGSDRLTSP 1397 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,942 Number of Sequences: 438 Number of extensions: 3827 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -