BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00022 (509 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101312-3|AAC69219.1| 83|Caenorhabditis elegans Ribosomal pro... 147 5e-36 U23517-8|AAM98041.1| 605|Caenorhabditis elegans A kinase anchor... 31 0.64 U23517-7|AAM98040.1| 1284|Caenorhabditis elegans A kinase anchor... 31 0.64 AC024200-2|AAF35997.2| 189|Caenorhabditis elegans Hypothetical ... 29 2.0 U58751-7|AAB00658.2| 729|Caenorhabditis elegans Hepatocyte grow... 28 4.5 AF003130-2|AAB54125.2| 426|Caenorhabditis elegans Adaptin, mu/m... 27 6.0 >AF101312-3|AAC69219.1| 83|Caenorhabditis elegans Ribosomal protein, small subunitprotein 27 protein. Length = 83 Score = 147 bits (356), Expect = 5e-36 Identities = 63/82 (76%), Positives = 71/82 (86%) Frame = +3 Query: 9 MPLAIDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCS 188 MPLA+DLLHP P E R HKLKRLV HPNSYFMDVKC GC+KI+TVFSHA VVVC GC+ Sbjct: 1 MPLAVDLLHPEPQREIRCHKLKRLVQHPNSYFMDVKCSGCFKISTVFSHATTVVVCVGCN 60 Query: 189 TILCQPTGGRARLTEGCSFRRK 254 T+LCQPT G+A+LTEGCSFR+K Sbjct: 61 TVLCQPTRGKAKLTEGCSFRKK 82 >U23517-8|AAM98041.1| 605|Caenorhabditis elegans A kinase anchor protein protein1, isoform c protein. Length = 605 Score = 30.7 bits (66), Expect = 0.64 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 39 SPASERRKHKLKRLVPHPNSYFM-DVKCPGCYKITTVFSHAQRVVVCAGCSTILC 200 +P ERR + + + + Y++ D +CP C T F+ R C C +LC Sbjct: 517 TPRRERRLTESELQLGKTSPYWIPDSECPNCMLCNTRFTIITRRHHCRACGRVLC 571 >U23517-7|AAM98040.1| 1284|Caenorhabditis elegans A kinase anchor protein protein1, isoform b protein. Length = 1284 Score = 30.7 bits (66), Expect = 0.64 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 39 SPASERRKHKLKRLVPHPNSYFM-DVKCPGCYKITTVFSHAQRVVVCAGCSTILC 200 +P ERR + + + + Y++ D +CP C T F+ R C C +LC Sbjct: 517 TPRRERRLTESELQLGKTSPYWIPDSECPNCMLCNTRFTIITRRHHCRACGRVLC 571 >AC024200-2|AAF35997.2| 189|Caenorhabditis elegans Hypothetical protein Y71F9AL.10 protein. Length = 189 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 30 LHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVC 176 LH +P H +R VP + MD+KCP C+K+ +V+C Sbjct: 81 LHATPGRLHGHHS-RRSVP---VFMMDMKCPVCHKVVPSDDADIHLVMC 125 >U58751-7|AAB00658.2| 729|Caenorhabditis elegans Hepatocyte growth factor-regulatedtk substrate (hrs) family protein 1 protein. Length = 729 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 120 PGCYKITTVFSHAQRVVVCAGCSTILCQPTGGR 218 P CY+ +VFS R C C I C R Sbjct: 161 PECYRCRSVFSVFTRKHHCRACGQIFCDKCSSR 193 >AF003130-2|AAB54125.2| 426|Caenorhabditis elegans Adaptin, mu/medium chain (clathrinassociated complex) protein 1 protein. Length = 426 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 359 LSITNKGFFKGNLVFHYKKNNQITIVSSLIYLFIKVYCTIF 481 +S T + LV KKN + +V S +Y ++V+C F Sbjct: 55 ISYTYIKYMNVYLVTISKKNTNVILVLSALYKIVEVFCEYF 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,001,079 Number of Sequences: 27780 Number of extensions: 217764 Number of successful extensions: 465 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 988489374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -