BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00021 (562 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G7.06 |met16||phosphoadenosine phosphosulfate reductase|Sc... 27 1.4 SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 27 2.5 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 26 3.3 SPAC688.04c |gst3||glutathione S-transferase |Schizosaccharomyce... 26 4.4 SPAC29A4.15 |||serine-tRNA ligase|Schizosaccharomyces pombe|chr ... 25 7.6 SPAC19E9.02 |fin1||serine/threonine protein kinase Fin1|Schizosa... 25 7.6 >SPAC13G7.06 |met16||phosphoadenosine phosphosulfate reductase|Schizosaccharomyces pombe|chr 1|||Manual Length = 266 Score = 27.5 bits (58), Expect = 1.4 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +2 Query: 173 TQPIRAGQGGRVSNREPVFKTEAGAGSQDEQKSAALRAHL 292 TQP+R G+ R KTE G S + K A A L Sbjct: 219 TQPVREGEDERAGRWRGREKTECGLHSHPQSKFAQYMAEL 258 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 26.6 bits (56), Expect = 2.5 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +3 Query: 132 EKIERHIMKSVPGGHNLFVQDKEVASLIENLYSKLKLVLVRKMNRNQRRYELI 290 +KIERHI S+ L + D ++E+L++ L V+ + R ++I Sbjct: 67 KKIERHIYISLNSIQLLAINDALSPDILESLFNSLNAVIQLGQDSQLRVLQII 119 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 26.2 bits (55), Expect = 3.3 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -2 Query: 234 VLNTGSR-LETRPPCPARIGCVPLARTS*CDVRSFRSQVSPAH 109 VLN G R LET PP P+ P+A + R+ SQ P H Sbjct: 258 VLNIGDRSLETPPPIPSPRPPQPVAVEAIQQSRAVISQQLPLH 300 >SPAC688.04c |gst3||glutathione S-transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 242 Score = 25.8 bits (54), Expect = 4.4 Identities = 13/55 (23%), Positives = 28/55 (50%) Frame = +3 Query: 48 KPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASL 212 + PP + PI++D+G+ +E+ I H+++ G + +++VA L Sbjct: 37 RAPPAYTKLSPLGKSPIVVDDGVTYIESAAILEHLVRKY--GPSFKPSEEDVAEL 89 >SPAC29A4.15 |||serine-tRNA ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.0 bits (52), Expect = 7.6 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +2 Query: 104 R*WA--GDT*ERKDRTSHHEVRAR--GTQPIRAGQGGRVSNREPVFKTEAG 244 R WA G T E+K+ SHHEV R G P R G +VS F + G Sbjct: 129 RKWAPEGVTVEKKNCLSHHEVLTRLDGYDPER---GVKVSGHRGYFLRQYG 176 >SPAC19E9.02 |fin1||serine/threonine protein kinase Fin1|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 25.0 bits (52), Expect = 7.6 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -1 Query: 454 PQSTERRRYLEVHEVLPADADVLHLRHQLAVETAHSVAR*EPGLPA 317 P ++ R LE V+ +D+LH +HQ+ ++ + + E L A Sbjct: 279 PILSDIRSKLESERVVLEQSDLLHKKHQMLIQLENDLQFREQRLSA 324 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,105,494 Number of Sequences: 5004 Number of extensions: 39059 Number of successful extensions: 136 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -