BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00020 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 25 2.4 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 25 2.4 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 23 7.2 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 7.2 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.6 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 25.0 bits (52), Expect = 2.4 Identities = 17/70 (24%), Positives = 27/70 (38%) Frame = -1 Query: 212 GLIANGSCITILPLCSAAAVASDLMEVPMNTPXXQSRXSTTSGTPAGRLPPSRMADIGTP 33 G++ T P A V S + + P + S+ P G LPP + +P Sbjct: 40 GVLPASKMPTSYPSLPAPIVPSPGAPIQQSRPQAVTVRSSAPMLPKGGLPPKGVPSSASP 99 Query: 32 SEFSHSPSIM 3 S + S+M Sbjct: 100 VYMSPASSLM 109 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 25.0 bits (52), Expect = 2.4 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 250 WLRCRSRDATCPRSSTSTGSVKMNRVSSSGPXSAR 354 WLR S SS+S S N SSSG S R Sbjct: 32 WLRGNSGSPLSSISSSSRNSSSCNNSSSSGTHSDR 66 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 6 DRR*MGELGGCADIRHP 56 +RR + ELG C ++HP Sbjct: 180 ERRVLKELGFCVHVKHP 196 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 275 QHAQDLPRQLVP 310 QH QDLP QL P Sbjct: 341 QHKQDLPEQLEP 352 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.6 Identities = 18/62 (29%), Positives = 28/62 (45%) Frame = -3 Query: 714 IYIF*NLNTNYLHFRILIDSFNFISLV*FKAWACMFFLNLFNSSHISLGRSSPTSSLKYF 535 +YI L++ R L D + +L K +F + FN IS + P+SS Y Sbjct: 188 VYIPPQLSSEISTLRSLHDCISSFTLR-LKPSDLLFVIGDFNQPSISWSTADPSSSPAYS 246 Query: 534 SM 529 S+ Sbjct: 247 SI 248 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 734,586 Number of Sequences: 2352 Number of extensions: 15556 Number of successful extensions: 119 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -