BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00018 (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z36948-1|CAA85409.1| 180|Caenorhabditis elegans Hypothetical pr... 38 0.008 Z81037-7|CAB02744.2| 431|Caenorhabditis elegans Hypothetical pr... 27 8.7 >Z36948-1|CAA85409.1| 180|Caenorhabditis elegans Hypothetical protein D2089.2 protein. Length = 180 Score = 37.5 bits (83), Expect = 0.008 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 200 CKCPGYTSILHYVELGLARYWLLTLSNTHCNCCQDELHLLPSHL 331 C C G + YV G W+ T SN C CQD L+P+ L Sbjct: 42 CSCSGTVA---YVHNGCLEQWVRTTSNIQCTICQDMFELIPAGL 82 >Z81037-7|CAB02744.2| 431|Caenorhabditis elegans Hypothetical protein C17E4.3 protein. Length = 431 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 200 CKCPGYTSILHYVELGLARYWLLTLSNTHCNCCQ 301 CKC G + H L +WL S T+C C+ Sbjct: 38 CKCSGTMGLFHRSCL---EHWLTLTSTTNCEICK 68 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,381,051 Number of Sequences: 27780 Number of extensions: 257921 Number of successful extensions: 560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -