BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00018 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 1.9 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 4.5 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 7.8 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 7.8 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 7.8 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.4 bits (48), Expect = 1.9 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +2 Query: 221 SILHYVELGLARYWLLTLSNTHCNCCQDELHLLPSHLLNRSY*VLVMLIWI 373 SIL+ + L RYW +T T+ PS + R VL+ ++WI Sbjct: 133 SILNLCVISLDRYWAITDPFTY-----------PSKMSRRRAAVLIAIVWI 172 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 530 RLTLHIYLLGIDHLPSQIHHTHLNGLRETS 619 R+++H LLG D + +I H+ + R S Sbjct: 415 RMSIHDELLGADLVEHRIRHSQIGISRAMS 444 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 221 SILHYVELGLARYWLLT 271 SIL+ + L RYW +T Sbjct: 123 SILNLCAIALDRYWAIT 139 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 221 SILHYVELGLARYWLLT 271 SIL+ + L RYW +T Sbjct: 123 SILNLCAIALDRYWAIT 139 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 221 SILHYVELGLARYWLLT 271 SIL+ + L RYW +T Sbjct: 123 SILNLCAIALDRYWAIT 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,014 Number of Sequences: 438 Number of extensions: 3010 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -