BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00016 (511 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 64 1e-11 SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 64 1e-11 SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|... 60 3e-10 SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosacch... 27 1.6 SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A... 27 1.6 SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B sub... 27 1.6 SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2... 27 1.6 SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 8.7 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 64.1 bits (149), Expect = 1e-11 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +3 Query: 87 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVR 254 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG +++ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLK 56 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 385 SDDDMGFGLFD 417 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 64.1 bits (149), Expect = 1e-11 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +3 Query: 87 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVR 254 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG +++ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLK 56 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 385 SDDDMGFGLFD 417 SD+DMGFGLFD Sbjct: 99 SDEDMGFGLFD 109 >SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 59.7 bits (138), Expect = 3e-10 Identities = 26/56 (46%), Positives = 41/56 (73%) Frame = +3 Query: 87 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVR 254 +S +ELA Y+ALIL D+ + +T +K+ ++ KA V+VEP W +FAKALEG +++ Sbjct: 1 MSASELATSYAALILADEGIEITSDKLLSLTKAGNVEVEPIWATIFAKALEGKDLK 56 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 385 SDDDMGFGLFD 417 SD+DMGFGLFD Sbjct: 99 SDEDMGFGLFD 109 >SPCC18.14c |rpp0||60S acidic ribosomal protein Rpp0 |Schizosaccharomyces pombe|chr 3|||Manual Length = 312 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 385 SDDDMGFGLFD 417 SD+DMGFGLFD Sbjct: 302 SDEDMGFGLFD 312 >SPBP8B7.06 |rpp201|rpp2, rpp2-1|60S acidic ribosomal protein P2A subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 385 SDDDMGFGLFD 417 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPBC23G7.15c |rpp202|rpp2-2|60S acidic ribosomal protein P2B subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 385 SDDDMGFGLFD 417 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC1071.08 |rpp203|rpp2-3, rla6|60S acidic ribosomal protein P2C subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 110 Score = 27.1 bits (57), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 Query: 385 SDDDMGFGLFD 417 SD+DMGFGLFD Sbjct: 100 SDEDMGFGLFD 110 >SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 24.6 bits (51), Expect = 8.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 51 GLRQLARSKLKMVSKAELACVYSAL 125 G+ QL + ++SKA+L C Y L Sbjct: 159 GMLQLDMPHVNILSKADLLCTYGTL 183 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,708,026 Number of Sequences: 5004 Number of extensions: 29436 Number of successful extensions: 77 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -