BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS00016
(511 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.1
AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 5.6
AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 9.8
AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 9.8
>AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor
protein.
Length = 1770
Score = 23.8 bits (49), Expect = 1.1
Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 5/37 (13%)
Frame = -3
Query: 491 SQFLIT*KLYNRQNGIF-----LFLHKAS*SKRPKPM 396
S+ +++ +LY+RQNG+ L L K + +P PM
Sbjct: 275 SKMMVSPRLYDRQNGLVLSRMNLTLAKMEKTSKPLPM 311
>AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein.
Length = 226
Score = 21.4 bits (43), Expect = 5.6
Identities = 6/13 (46%), Positives = 9/13 (69%)
Frame = +1
Query: 271 RLWSGCCSGRWWS 309
R+ + CC+ WWS
Sbjct: 195 RVPATCCTTXWWS 207
>AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein.
Length = 996
Score = 20.6 bits (41), Expect = 9.8
Identities = 6/10 (60%), Positives = 8/10 (80%)
Frame = +2
Query: 173 HLESGGCRCR 202
+L SGGC C+
Sbjct: 241 YLPSGGCHCK 250
>AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein
75 protein.
Length = 900
Score = 20.6 bits (41), Expect = 9.8
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = -3
Query: 434 LHKAS*SKRPKP 399
LH+AS SK P+P
Sbjct: 554 LHRASLSKTPQP 565
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 114,763
Number of Sequences: 438
Number of extensions: 2148
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14109465
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -