BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00014 (589 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0183 - 1350451-1350477,1350887-1350969,1350977-1352696,135... 29 2.1 11_01_0183 - 1440460-1440467,1440832-1440957,1440965-1442858 29 2.1 06_02_0023 + 10702040-10702364,10702530-10702747,10703643-107041... 29 3.6 03_02_0067 + 5364713-5364936,5365513-5367016,5367207-5368250,536... 28 4.8 01_06_0517 + 29981537-29981927,29982024-29982231,29982373-299825... 28 6.3 07_03_0944 + 22787933-22789906 27 8.4 >12_01_0183 - 1350451-1350477,1350887-1350969,1350977-1352696, 1354258-1354428,1355892-1355939 Length = 682 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 114 DELVIVEVPTKGGLRNDEDDTSVLI 40 DE + V + + GG ND+DDT +L+ Sbjct: 259 DETLAVCIISSGGYENDDDDTDILV 283 >11_01_0183 - 1440460-1440467,1440832-1440957,1440965-1442858 Length = 675 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 114 DELVIVEVPTKGGLRNDEDDTSVLI 40 DE + V + + GG ND+DDT +L+ Sbjct: 244 DETLAVCIISSGGYENDDDDTDILV 268 >06_02_0023 + 10702040-10702364,10702530-10702747,10703643-10704190, 10704272-10704523,10704611-10704721,10704812-10704893, 10704969-10705061,10705146-10705340 Length = 607 Score = 28.7 bits (61), Expect = 3.6 Identities = 23/78 (29%), Positives = 34/78 (43%) Frame = -2 Query: 240 IVFNDIHAIFDIYKPTFQYVNNSSSKMCINKTRCEFDIGFFSDELVIVEVPTKGGLRNDE 61 I FND+HA F + K V ++ R E IG+ + +V T +R E Sbjct: 340 ISFNDLHAFFKMDKMDINLVGTWCLSQWVDAQRTEASIGYVNPTMVCETAHT---VRISE 396 Query: 60 DDTSVLISVCLPRKSVYI 7 D++VL + K YI Sbjct: 397 -DSAVLKNKTHQEKKDYI 413 >03_02_0067 + 5364713-5364936,5365513-5367016,5367207-5368250, 5368467-5368577,5368997-5369068,5369719-5369737, 5369838-5371142,5371317-5371397,5372441-5372604, 5373363-5373466,5373537-5373628,5374079-5374216, 5374370-5374426,5374820-5375046 Length = 1713 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = -3 Query: 404 NLYDCYQDNIL---MNEYFPFSIQCNSTNYLEETTILKVIHEVLVDGYYY 264 N++ + D IL + + Q NS + ++ T+LKV+ E+L +G ++ Sbjct: 262 NIFRTFVDRILDPLLELLVLLNSQVNSLTHKQDRTMLKVVEEILSNGLFH 311 >01_06_0517 + 29981537-29981927,29982024-29982231,29982373-29982544, 29984468-29984533,29984658-29984771,29984880-29984996, 29985097-29985223,29985317-29985603,29985701-29985891, 29985981-29986063,29986175-29986251,29986729-29986896 Length = 666 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 475 TPVSRIVLGLCIWCVYLFFAAFYLCLM*IVISS 573 TP+S +V+ +CI V LF A + + +SS Sbjct: 414 TPMSNVVMSVCIMLVLLFLAPLFKYTPLVALSS 446 >07_03_0944 + 22787933-22789906 Length = 657 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -2 Query: 201 KPTFQYVNNSSSKMCINKTRCEFDIGFFSDELVIVEVPTKGGLRNDEDDTS 49 +P+ NSS+ + + D G S+ELV + P + G DE D S Sbjct: 550 RPSVGSPRNSSAWGTVGSPMGKVDWGVDSEELVRLRRPAQPGFGEDETDVS 600 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,872,666 Number of Sequences: 37544 Number of extensions: 264342 Number of successful extensions: 597 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -