BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00013 (760 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22E12.15 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 6.7 SPAC23H4.07c |srp102||signal recognition particle receptor beta ... 26 6.7 >SPAC22E12.15 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 59 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 659 VQGKLSYIQVPNNNIRTVGLPSN 591 V+GKL ++ VPN ++ V L +N Sbjct: 2 VKGKLKWVAVPNLTLKFVNLDTN 24 >SPAC23H4.07c |srp102||signal recognition particle receptor beta subunit Srp102 |Schizosaccharomyces pombe|chr 1|||Manual Length = 227 Score = 25.8 bits (54), Expect = 6.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 464 ILILFLTSSVTVFVVR-TKSKKLPYYLLCGDYDKGK 568 I+I + S++ +F R T KKLP L G D GK Sbjct: 15 IIIGAIISTLGIFFTRKTIQKKLPAVFLIGPSDSGK 50 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,086,970 Number of Sequences: 5004 Number of extensions: 63871 Number of successful extensions: 148 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 148 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -