BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00013 (760 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1022 - 8815675-8816809,8819696-8819907 29 5.3 04_01_0055 + 576483-576584,576684-576865,576950-577316,577391-57... 29 5.3 >07_01_1022 - 8815675-8816809,8819696-8819907 Length = 448 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 547 WGLRQRERSSTERVILLGRPTVRMLLFGT 633 W LR RS+ ER++ GRP R L+ T Sbjct: 290 WPLRAAFRSAIERLLTSGRPRPRTLVLAT 318 >04_01_0055 + 576483-576584,576684-576865,576950-577316,577391-578065 Length = 441 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +2 Query: 569 DLPPSG*YYSVDRRSECCCSELVYTKAYLEHVVSEIRAYVKYLVCYDGY 715 DLP +G YYS RR+ C + A VV I+A +V DGY Sbjct: 313 DLPAAGDYYSFMRRARFCLCPSGHEVA-SPRVVEAIQAECVPVVIADGY 360 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,607,876 Number of Sequences: 37544 Number of extensions: 360606 Number of successful extensions: 714 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -