BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00010 (717 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0411 + 3670758-3672365 33 0.23 03_06_0003 + 30921197-30921388,30921514-30921632,30921742-309218... 30 2.1 09_04_0717 + 19706160-19706327,19707036-19707157,19707408-197075... 29 3.7 02_05_1308 + 35601314-35601390,35602486-35602566,35603513-356040... 29 4.9 08_02_0459 + 17420156-17420976,17422291-17424199 28 8.5 >08_01_0411 + 3670758-3672365 Length = 535 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +1 Query: 301 CYYLGGLEESATGILGELSKPLSWSMPADKICEKLKKKDAQICDLRF 441 CY G A + + KP W MP +K + +Q+ DLRF Sbjct: 261 CYAKNGCAREALAVFNRMLKPHVWVMPNEKTFSSVISACSQLGDLRF 307 >03_06_0003 + 30921197-30921388,30921514-30921632,30921742-30921811, 30922078-30922161,30922258-30922344,30922431-30922501, 30922648-30922702,30923374-30923509,30925009-30925103, 30925203-30925357,30925435-30925543,30925761-30925817, 30925913-30926027,30926177-30926264,30926738-30927501, 30927600-30927688,30928315-30928422,30928550-30928657, 30928887-30928977,30929235-30929287,30929557-30929712, 30930763-30930825,30931491-30931535,30932075-30932130, 30933051-30933132,30933238-30933354,30933428-30933530, 30933912-30934062,30934180-30934417,30934564-30934764, 30934850-30934935,30935036-30935135 Length = 1347 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 141 RWSYHFEKVIAKCV*KL*RSLPPRYQMM*RKTLKKSRQ-VQKVL*RFKEQRK 293 +WS F IAKC+ K R P +M+ K ++K K+L + KE +K Sbjct: 988 KWSLLFHDFIAKCLTKDPRLRPAASEMLKHKFIEKCNPGASKMLAKIKEAKK 1039 >09_04_0717 + 19706160-19706327,19707036-19707157,19707408-19707510, 19707644-19707734,19707960-19708132,19708534-19708622, 19708995-19709085,19709272-19709361,19709807-19709854, 19710033-19710104,19710181-19710274,19710350-19710494, 19710809-19710951,19711601-19711751,19712276-19712449, 19712799-19712874 Length = 609 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -2 Query: 446 LSNLRSQICASFFFNFSHILSAGIDQLKGFDNSPKMPVADSSRPP 312 LS L S + ++F N L AG+ ++ D S + + S +PP Sbjct: 424 LSGLTS-VTRNYFENLVQTLEAGLQDVRATDQSASVSTSSSKKPP 467 >02_05_1308 + 35601314-35601390,35602486-35602566,35603513-35604064, 35604998-35605408,35606830-35607544 Length = 611 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +3 Query: 516 WDEVCDGCIEKTDFIKRIEELKPKYMGRS 602 WD VC G ++TD+ +++EE+ + +GR+ Sbjct: 504 WDAVCSGGEDETDW-RKVEEILRRCIGRN 531 >08_02_0459 + 17420156-17420976,17422291-17424199 Length = 909 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -3 Query: 370 NLRALTILPKCRWLTLRDLLNSNKIYFLCSLNLYRT 263 +LR L+ CRWL + L N K++ L LNL +T Sbjct: 571 HLRVLSF-QGCRWLQSQHLANIGKLFQLRFLNLRKT 605 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,004,141 Number of Sequences: 37544 Number of extensions: 314315 Number of successful extensions: 696 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -