BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00010 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 6.7 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 8.8 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 8.8 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 626 LGELSTFTL*YQHHADLLCDVIW 694 +G+L+ T H AD+ D +W Sbjct: 48 IGDLNGITARMDHIADIGADALW 70 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +2 Query: 41 YIEVSKFITHEFKYSSKMFKFSLFHLLFLAT 133 ++EV++ I + + S+K+ + +L HL+ +A+ Sbjct: 383 HVEVARLIRNYYFESNKIDETTLKHLIDVAS 413 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/31 (29%), Positives = 22/31 (70%) Frame = +2 Query: 41 YIEVSKFITHEFKYSSKMFKFSLFHLLFLAT 133 ++EV++ I + + S+K+ + +L HL+ +A+ Sbjct: 383 HVEVARLIRNYYFESNKIDETTLKHLIDVAS 413 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,691 Number of Sequences: 438 Number of extensions: 3321 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -