BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00009 (689 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 4e-22 SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) 69 3e-12 SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) 69 3e-12 SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) 69 3e-12 SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) 69 3e-12 SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 69 4e-12 SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 4e-12 SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) 69 5e-12 SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) 69 5e-12 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) 67 1e-11 SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) 65 4e-11 SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) 65 4e-11 SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) 65 6e-11 SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) 65 6e-11 SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) 62 3e-10 SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) 62 4e-10 SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) 59 3e-09 SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) 59 3e-09 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 49 3e-06 SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) 44 1e-04 SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.094 SB_41324| Best HMM Match : BLUF (HMM E-Value=9) 31 0.67 SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 30 1.5 SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) 29 4.7 SB_56837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) 28 8.2 SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) 28 8.2 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 101 bits (243), Expect = 4e-22 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNA K Sbjct: 96 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASK 145 Score = 78.6 bits (185), Expect = 4e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV 364 + G +KDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV Sbjct: 139 LAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV 180 >SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 134 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 31 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 79 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 73 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 127 >SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 393 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 441 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 435 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 489 >SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 32/55 (58%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ ATIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGATIAQGGVLPNIQASLLPKK 119 >SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 58.4 bits (135), Expect = 5e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA G V+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGRVLPNIQASLLPKK 119 >SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 126 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 760 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 808 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/55 (54%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ KK Sbjct: 802 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLRGVTIAQGGVLPNIQAVLLPKK 856 >SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 68.9 bits (161), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) Length = 125 Score = 68.5 bits (160), Expect = 5e-12 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNA 254 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNA 69 Score = 59.7 bits (138), Expect = 2e-09 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAACDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_58649| Best HMM Match : Histone (HMM E-Value=4.5e-12) Length = 74 Score = 68.5 bits (160), Expect = 5e-12 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFP+GRIHRHL+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPIGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAAR 71 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 68.5 bits (160), Expect = 5e-12 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPV R+HR+L+ + T H R+ A A VY AA++EYLTAE+LELAGNA + Sbjct: 658 LQFPVSRVHRYLR-KCTHHYRISAAAPVYQAAVMEYLTAEILELAGNAAR 706 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGG 406 + G A+D K RI PRH+ LA+ DEEL L+K TIA GGV+P+IH L+ K+ G Sbjct: 700 LAGNAARDNKKTRIIPRHILLAVANDEELHKLLKGVTIASGGVLPNIHPELLKKRKG 756 >SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) Length = 125 Score = 66.9 bits (156), Expect = 1e-11 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHRHL+ + RVGA A V+ AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVHLAAVLEYLSAEILELAGNAAR 71 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 330 Score = 65.3 bits (152), Expect = 4e-11 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 119 >SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 65.3 bits (152), Expect = 4e-11 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRVHRFLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) Length = 125 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGR+HR L+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRVHRFLRKGNYAK-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 58.0 bits (134), Expect = 7e-09 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TI+ GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTISQGGVLPNIQAVLLPKK 119 >SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) Length = 126 Score = 64.9 bits (151), Expect = 6e-11 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHR L+ + RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRLLRKGNYAE-RVGAGAPVYMAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 63.3 bits (147), Expect = 2e-10 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKKGGPG 412 + G A+D K RI PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ KK G Sbjct: 29 LAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVTIAQGGVLPNIQAVLLPKKSNTG 87 Score = 49.2 bits (112), Expect = 3e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 171 RVGATAAVYSAAILEYLTAEVLELAGNALK 260 RVGA A VY AA+LEYLTAE+LELAGNA + Sbjct: 6 RVGAGAPVYMAAVLEYLTAEILELAGNAAR 35 >SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) Length = 126 Score = 62.5 bits (145), Expect = 3e-10 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNALK 260 LQFPVGRIHR L+ + RVGA VY AA+LEYL+AE+LELAGNA + Sbjct: 23 LQFPVGRIHRLLRKGNYAE-RVGAGDPVYMAAVLEYLSAEILELAGNAAR 71 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 65 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_44162| Best HMM Match : Histone (HMM E-Value=0.00016) Length = 67 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELA 245 LQFPVGRIHRHL+ + RVGA A VY AA+LEYL+AE+LELA Sbjct: 23 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELA 66 >SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) Length = 76 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 15 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 69 Score = 35.5 bits (78), Expect = 0.041 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +3 Query: 201 AAILEYLTAEVLELAGNALK 260 AA+LEYL+AE+LELAGNA + Sbjct: 2 AAVLEYLSAEILELAGNAAR 21 >SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) Length = 90 Score = 59.3 bits (137), Expect = 3e-09 Identities = 30/55 (54%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKK 400 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ KK Sbjct: 29 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 83 Score = 47.6 bits (108), Expect = 9e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +3 Query: 171 RVGATAAVYSAAILEYLTAEVLELAGNALK 260 RVGA A VY AA+LEYL+AE+LELAGNA + Sbjct: 6 RVGAGAPVYMAAVLEYLSAEILELAGNAAR 35 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 49.2 bits (112), Expect = 3e-06 Identities = 25/43 (58%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = +2 Query: 239 VGGKCAKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGV 364 + G A+D K RI PRHLQLA+R DEEL+ L+ TIA GGV Sbjct: 12 LAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGV 54 Score = 31.1 bits (67), Expect = 0.88 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = +3 Query: 210 LEYLTAEVLELAGNALK 260 LEYL+AE+LELAGNA + Sbjct: 2 LEYLSAEILELAGNAAR 18 >SB_30055| Best HMM Match : Histone (HMM E-Value=0.97) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAIL 212 LQFPVGRIHRHL+ + RVGA A VY AA+L Sbjct: 96 LQFPVGRIHRHLRKGNYAE-RVGAGAPVYMAAVL 128 >SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 35.9 bits (79), Expect = 0.031 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = +2 Query: 299 LAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGKK 400 LA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 1 LAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKR 35 >SB_55494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 34.3 bits (75), Expect = 0.094 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = +3 Query: 111 LQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVL 236 L FPVGRI R L + + RV AA+Y AA LEY+ E + Sbjct: 72 LVFPVGRIFRWLLDMKVAC-RVYDAAAIYLAATLEYIAEETI 112 >SB_41324| Best HMM Match : BLUF (HMM E-Value=9) Length = 192 Score = 31.5 bits (68), Expect = 0.67 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +2 Query: 155 DNKPRARRSYGSSLFCRYFGI--SYSRGFGVGGKCAKDLKVKRITPRHLQLAIRG 313 D+ PR ++Y ++F RY + SY +G+ G + +R+T R IRG Sbjct: 21 DSAPRTLQAYTEAMFTRYRPLNNSYGYAYGLDGTTLTVRRKRRLTVRKFVRQIRG 75 >SB_44025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 35 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +3 Query: 111 LQFPVGRIHRHL 146 LQFPVGRIHRHL Sbjct: 23 LQFPVGRIHRHL 34 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 203 RYFGISYSRGFGVGGKCAKDL-KVKRITPRHLQLAIRGDEELDSL 334 RY + SRG+G GG C K+ I H L GD +D L Sbjct: 2725 RYDDLCRSRGWGAGGMCPPIFSKIVVIKGNHYSLGALGDIAIDDL 2769 >SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) Length = 593 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 278 ITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGGPG 412 +T +H+ + R + LIK + G H+H+ L G++ G Sbjct: 207 LTAKHINITNRTANVVKKLIKIGLLTNGSTTHVHRFLKGQRNNTG 251 >SB_56837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 8/77 (10%) Frame = +3 Query: 396 RKAVLVHPFNFKYVLLKSVFNSYFEQVPTFIL---YFTLAGFVKYLNNI-----MFY*SY 551 R+ + PFN ++ +L+ + N + V FIL +F+ G +K + + + + Sbjct: 412 RRIIYSAPFNIEFEMLEIIMNELHDIVDVFILVESHFSAFGTIKPVRLLPRLHRNYLRRF 471 Query: 552 HHSVSYLNVDCVFPSSA 602 H + YL +D FP+ A Sbjct: 472 HKKIIYLYMD-HFPTGA 487 >SB_38686| Best HMM Match : 7tm_1 (HMM E-Value=5.70048e-42) Length = 366 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 342 QLSLAEASSHTYTNLSLERKAVLVHPFNFK 431 Q +L S T+T ++LER ++HPF K Sbjct: 119 QDALVSVSVFTFTAIALERYRAIIHPFKPK 148 >SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) Length = 1602 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 320 ELDSLIKATIAGGGVIPHIHKSLIGKKGGP 409 ++ S++K TI+ + H+H +IG +G P Sbjct: 307 DMKSMLKLTISIASGLAHLHMEIIGTQGKP 336 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,917,860 Number of Sequences: 59808 Number of extensions: 399428 Number of successful extensions: 1711 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 1509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1634 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -