BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00004 (783 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0649 + 4698384-4698780,4699047-4699144,4699673-4699697,469... 29 5.5 11_06_0037 - 19478885-19480472,19483125-19483267 28 9.6 >06_01_0649 + 4698384-4698780,4699047-4699144,4699673-4699697, 4699809-4699929,4700022-4700156,4700392-4700602 Length = 328 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 152 RWFFVFILQNPNSC*LFDCVLNGTRLLLLEKHNSCSW 262 R F +L + N DC +G R+LL + HNS W Sbjct: 259 RSFGAQVLIDDNPRYALDCAEDGMRVLLFDYHNSYPW 295 >11_06_0037 - 19478885-19480472,19483125-19483267 Length = 576 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 206 CVLNGTRLLLLEKHNSCSWFMQSLCE 283 CV+ GTR+L+L H W + L E Sbjct: 540 CVVGGTRVLVLGGHTGEEWILNELHE 565 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,925,038 Number of Sequences: 37544 Number of extensions: 338949 Number of successful extensions: 649 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2103658836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -