BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00004 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.87 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 25 3.5 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 26.6 bits (56), Expect = 0.87 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -2 Query: 488 NEKV*KIYQVIFFQTREGVSAYYLCKVPVFVD 393 N++ K YQV F + REG + YY K +F D Sbjct: 9 NKQYFKRYQVRFRRRREGKTDYYARKRLIFQD 40 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 24.6 bits (51), Expect = 3.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 166 DEEPSVSVLDNVIPPSNLS 110 DE+ + VL N+I PS LS Sbjct: 337 DEQTGIDVLGNIIEPSALS 355 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 772,540 Number of Sequences: 2352 Number of extensions: 16222 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -