BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00002 (700 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2FND9 Cluster: Putative uncharacterized protein; n=1; ... 38 0.18 UniRef50_P40353 Cluster: Alcohol O-acetyltransferase 1; n=7; Sac... 35 2.2 >UniRef50_A2FND9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 1505 Score = 38.3 bits (85), Expect = 0.18 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = -3 Query: 302 AYTPCPFPKIDSSN*NEISTTTGYHYINKTQCELNITILLCCLVFGSVQQIQGHVEGY 129 ++ P + +N N+I T + +N + E NI+I L CL FG++ +I VE + Sbjct: 1209 SFIPTLLKRFSENNQNQIQTEIYKYLMNNLENEQNISIFLICLDFGNIDEITKKVEPF 1266 >UniRef50_P40353 Cluster: Alcohol O-acetyltransferase 1; n=7; Saccharomyces|Rep: Alcohol O-acetyltransferase 1 - Saccharomyces cerevisiae (Baker's yeast) Length = 525 Score = 34.7 bits (76), Expect = 2.2 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 88 FRAITTST*PGLGM*PSTWPCICCTEPKTKQQSKIVMLSSHCV 216 F+ TT T P G +W IC E T++ K + +S+HC+ Sbjct: 151 FKLTTTLTIPYFGPTGPSWRLICLPEEHTEKWKKFIFVSNHCM 193 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 691,858,666 Number of Sequences: 1657284 Number of extensions: 13642298 Number of successful extensions: 30344 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30341 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -