BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00002 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0971 + 24949137-24950534 28 8.2 01_07_0252 - 42296138-42296281,42296527-42296613,42297043-422971... 28 8.2 >12_02_0971 + 24949137-24950534 Length = 465 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +2 Query: 2 ARARTAYIGTP---ASSWTRRRILRGTSGPERSGRSQRPRDLA*EC 130 A AR Y+G+ + W RR G +GP R+G + R +A C Sbjct: 305 AEARVVYVGSSDGAVTHWQWRRGGAGVAGPPRNGGALRGHRMAVLC 350 >01_07_0252 - 42296138-42296281,42296527-42296613,42297043-42297135, 42297267-42297341,42297480-42297575,42297987-42298133, 42298225-42298296,42298912-42298959,42299507-42299607, 42300226-42300337,42300506-42300590,42300693-42300848, 42300956-42301047,42301155-42301238,42301676-42301726, 42302227-42302295,42302417-42302476,42303305-42303535 Length = 600 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 245 WRFRFNSTSQSLGMDKGYKLGSTHSHVPIFD 337 W F+ + + D G GST SH+ +FD Sbjct: 249 WMFKLSEWAHFSSYDVGLHSGSTASHILVFD 279 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,420,491 Number of Sequences: 37544 Number of extensions: 366354 Number of successful extensions: 773 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -