BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0576.Seq (596 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0530 - 34545699-34546013,34546121-34546354,34547006-345470... 28 4.9 09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172,158... 27 8.6 >03_06_0530 - 34545699-34546013,34546121-34546354,34547006-34547078, 34548226-34548299,34548852-34549004 Length = 282 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -2 Query: 385 FHNYFTHFMQETSEILMYKHNEREITQ*QLF*IMSTVPEIR-IDTR*IVIFPTKPA 221 +H+ F +E ++Y HNE + TQ + + +STVP R ++ I + P A Sbjct: 172 YHDTVHQFAPTYNEYVLYNHNEGDSTQ-RKYPSVSTVPSGRDVELSGISVMPANSA 226 >09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172, 1584676-1584745,1585132-1585197,1586374-1586429, 1587992-1588078,1588819-1589139,1589827-1589946, 1590747-1590881,1591529-1591605,1591681-1591756, 1592800-1592874,1592971-1593075,1593299-1593374, 1594482-1594617,1594702-1594804,1595186-1595298, 1596907-1597111,1597173-1597301,1597403-1597517, 1597710-1597795,1599108-1599203,1599615-1599751, 1600374-1600476,1601809-1601888,1602013-1602091, 1602241-1602298,1602489-1602586,1602673-1602767, 1602861-1602918 Length = 1074 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 499 LTRINEHFNIFYRNCCSREPHTGCREFLHT 588 L I EHFNI N C REFLH+ Sbjct: 146 LIEIIEHFNIDVENPCVIMSQDKSREFLHS 175 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,372,965 Number of Sequences: 37544 Number of extensions: 265171 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -