BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0576.Seq (596 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40390.1 68415.m04980 expressed protein 28 4.1 At1g26330.1 68414.m03211 hypothetical protein 27 7.2 At5g25050.1 68418.m02969 integral membrane transporter family pr... 27 9.5 >At2g40390.1 68415.m04980 expressed protein Length = 496 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 258 IQDELLFFQLNLHRAFDCISLEHQI 184 + DE LFF LN H+ I L H+I Sbjct: 243 LNDERLFFSLNYHQLEGVIQLNHRI 267 >At1g26330.1 68414.m03211 hypothetical protein Length = 1196 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = +1 Query: 373 NSYEIVMLQIVHNNAKLLLQI*YKMLCISVCNPNNYLVV----SLTLTRINEHFN 525 N+ IV ++ H + LQ + C+ VC+PNN + +L + +N H++ Sbjct: 914 NAVRIVQVKTGHVSLVTKLQADDSVQCVVVCDPNNLIAAVKSGNLIVWAMNSHWS 968 >At5g25050.1 68418.m02969 integral membrane transporter family protein similar to biopterin transporter (GI:3377706) [Leishmania mexicana]; contains 7 transmembrane domains; contains Pfam PF03092: BT1 family; contains TIGRFAMS TIGR00788: folate/biopterin transporter Length = 499 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 445 MLCISVCNPNNYLVVSLTLTRINEHFNIFY 534 M C V P+ Y+ +SLTL +N H +FY Sbjct: 256 MKCSDVWRPSLYMYISLTL-GLNIHEGLFY 284 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,605,297 Number of Sequences: 28952 Number of extensions: 218631 Number of successful extensions: 405 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -