BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0575.Seq (718 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.5 EF532798-1|ABQ08060.1| 50|Tribolium castaneum acetylcholineste... 22 5.7 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 7.6 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 7.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = +1 Query: 112 EYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAI 240 EYPKC+ V + + +R S KN ++ A+ Sbjct: 2443 EYPKCWQVDCNKGPDSDKEAFAAFVRELSAAFKPKNLLLSAAV 2485 >EF532798-1|ABQ08060.1| 50|Tribolium castaneum acetylcholinesterase protein. Length = 50 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +3 Query: 177 YLATWLQYRAHGKKHNDAQSHQRP 248 YL W+ R + H D +RP Sbjct: 15 YLNIWVPQRLRIRHHGDKPPQERP 38 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 79 NYFVKIIQLLDEYPKCF 129 N KI L+DE+ +CF Sbjct: 214 NLHNKICNLIDEFNECF 230 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 401 QWGNGTRTSW 372 Q+GNG TSW Sbjct: 274 QFGNGLETSW 283 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,176 Number of Sequences: 336 Number of extensions: 4119 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -