BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0573.Seq (584 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 22 4.4 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 5.8 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 5.8 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 269 FLRHFLESSEPSMRKYSSWVFAN 201 F + F +EP +R Y ++F N Sbjct: 81 FFQQFECDNEPKLRHYLIFIFVN 103 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 5.8 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 132 APWVLNAIGPIVKSGVIAHREPAKERLQFAERWNLIQHRLGQLG 1 A W+ N + ++S R PAK + + W + H + QLG Sbjct: 236 AVWMCNNLHKALES-----RNPAKILGAYRDLWVDLSHMMQQLG 274 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 5.8 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 132 APWVLNAIGPIVKSGVIAHREPAKERLQFAERWNLIQHRLGQLG 1 A W+ N + ++S R PAK + + W + H + QLG Sbjct: 236 AVWMCNNLHKALES-----RNPAKILGAYRDLWVDLSHMMQQLG 274 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,292 Number of Sequences: 336 Number of extensions: 2230 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14621740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -