BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0572.Seq (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 24 1.1 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 4.5 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +1 Query: 442 KTADVYIVVARKHDVKKDQYGYNARQFTRRYALPEGCTAESVESRLSSYG 591 KT++ + K + K QY N++ R+Y+ G +S R G Sbjct: 173 KTSEELKIPKAKINTGKTQYNLNSKSLPRQYSQSRGRHNQSRSKRQPKTG 222 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 21.8 bits (44), Expect = 4.5 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -1 Query: 517 DAHCNHTDLSSHRVCE 470 D+HC+HT + C+ Sbjct: 145 DSHCDHTTCKNGGTCQ 160 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,552 Number of Sequences: 336 Number of extensions: 2510 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -