BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0568.Seq (698 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; ... 102 1e-20 UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organ... 102 1e-20 UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: L... 102 1e-20 UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Bet... 102 1e-20 UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo... 77 3e-13 UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep:... 67 4e-10 UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; ... 54 3e-06 UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteoba... 54 3e-06 UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteoba... 44 0.003 UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia sp... 41 0.034 UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria... 40 0.078 UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. ... 39 0.14 UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus la... 36 0.96 UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barre... 36 1.3 UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 36 1.3 UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio choler... 34 2.9 UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barre... 34 3.9 UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma j... 33 6.7 UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; ... 33 8.9 UniRef50_Q2WGJ9 Cluster: C8orfK23 protein; n=24; Euteleostomi|Re... 33 8.9 >UniRef50_Q8GEG0 Cluster: Putative uncharacterized protein; n=1; Erwinia amylovora|Rep: Putative uncharacterized protein - Erwinia amylovora (Fire blight bacteria) Length = 123 Score = 102 bits (244), Expect = 1e-20 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 210 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 113 >UniRef50_Q47336 Cluster: LacZ-alpha peptide; n=2; cellular organisms|Rep: LacZ-alpha peptide - Escherichia coli Length = 90 Score = 102 bits (244), Expect = 1e-20 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 210 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 67 >UniRef50_Q37953 Cluster: LacZ protein; n=1; Phage M13mp18|Rep: LacZ protein - Phage M13mp18 Length = 102 Score = 102 bits (244), Expect = 1e-20 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 210 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 71 >UniRef50_P00722 Cluster: Beta-galactosidase; n=35; root|Rep: Beta-galactosidase - Escherichia coli (strain K12) Length = 1024 Score = 102 bits (244), Expect = 1e-20 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 210 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 53 >UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryota|Rep: beta-galactosidase - Entamoeba histolytica HM-1:IMSS Length = 86 Score = 77.4 bits (182), Expect = 3e-13 Identities = 39/55 (70%), Positives = 44/55 (80%), Gaps = 2/55 (3%) Frame = +2 Query: 71 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNS--CAXEWRMA 229 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVI++ A P+ + +WRMA Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVISEE-ARTDRPSQQLRSLKWRMA 58 >UniRef50_Q669R9 Cluster: Beta-galactosidase; n=14; Yersinia|Rep: Beta-galactosidase - Yersinia pseudotuberculosis Length = 1066 Score = 66.9 bits (156), Expect = 4e-10 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 204 L +L RRDWENP +TQ +RL AHPPF SWR+ E A+ DRPS Q Sbjct: 15 LPQILSRRDWENPQITQYHRLEAHPPFHSWRDVESAQKDRPSPQ 58 >UniRef50_A7MN76 Cluster: Putative uncharacterized protein; n=1; Enterobacter sakazakii ATCC BAA-894|Rep: Putative uncharacterized protein - Enterobacter sakazakii ATCC BAA-894 Length = 1043 Score = 54.4 bits (125), Expect = 3e-06 Identities = 20/42 (47%), Positives = 28/42 (66%) Frame = +1 Query: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 198 LA +L R DW+NP +T +NRL +H P WR+++ AR PS Sbjct: 18 LATILARNDWQNPAITSVNRLPSHTPLHGWRDADRARRGEPS 59 >UniRef50_P06219 Cluster: Beta-galactosidase; n=11; Gammaproteobacteria|Rep: Beta-galactosidase - Klebsiella pneumoniae Length = 1034 Score = 54.0 bits (124), Expect = 3e-06 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +1 Query: 82 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 210 VL R DW N +T LNRL AHP FASWR+ AR + PS + R Sbjct: 17 VLAREDWHNQTITHLNRLPAHPVFASWRDELAARDNLPSSRRR 59 >UniRef50_P81650 Cluster: Beta-galactosidase; n=26; Gammaproteobacteria|Rep: Beta-galactosidase - Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) Length = 1039 Score = 44.4 bits (100), Expect = 0.003 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +1 Query: 82 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 204 ++ RRDWENP Q+N++ AH P ++ E+AR + SQ+ Sbjct: 7 IINRRDWENPITVQVNQVKAHSPLNGFKTIEDARENTQSQK 47 >UniRef50_A0ZLG1 Cluster: Beta-D-galactosidase; n=1; Nodularia spumigena CCY 9414|Rep: Beta-D-galactosidase - Nodularia spumigena CCY 9414 Length = 72 Score = 40.7 bits (91), Expect = 0.034 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 160 WRNSEEARTDRPSQQLR 210 WRNSEEARTDRPSQQLR Sbjct: 47 WRNSEEARTDRPSQQLR 63 >UniRef50_A6FJQ2 Cluster: 50S ribosomal protein L5; n=8; Bacteria|Rep: 50S ribosomal protein L5 - Moritella sp. PE36 Length = 45 Score = 39.5 bits (88), Expect = 0.078 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -3 Query: 231 FAIRHSXAQLLGRAIGAGLFAITPAGERG 145 FAI+ AQLLGRAIGAGLFAITP E G Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPEFELG 38 >UniRef50_A7BPF2 Cluster: LacZ alpha peptide; n=1; Beggiatoa sp. SS|Rep: LacZ alpha peptide - Beggiatoa sp. SS Length = 73 Score = 38.7 bits (86), Expect = 0.14 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = -1 Query: 554 GFPRQALNRGLPLGFHLVLYGTSTPKNL 471 GFPRQALNRGLPLGF PK L Sbjct: 45 GFPRQALNRGLPLGFRFSALRHLDPKKL 72 >UniRef50_Q48727 Cluster: Beta-galactosidase; n=3; Lactococcus lactis|Rep: Beta-galactosidase - Lactococcus lactis subsp. lactis (Streptococcus lactis) Length = 998 Score = 35.9 bits (79), Expect = 0.96 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 82 VLQRRDWENPGVTQLNRLAAHPP 150 VL+R+DWENP V+ NRL H P Sbjct: 9 VLERKDWENPVVSNWNRLPMHTP 31 >UniRef50_A0UVE2 Cluster: Glycoside hydrolase family 2, TIM barrel; n=1; Clostridium cellulolyticum H10|Rep: Glycoside hydrolase family 2, TIM barrel - Clostridium cellulolyticum H10 Length = 1033 Score = 35.5 bits (78), Expect = 1.3 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +1 Query: 94 RDWENPGVTQLNRLAAHPPFASWRNSEEA 180 R+WEN +TQ+NR H P+ ++ + E+A Sbjct: 3 REWENQYITQINRYPMHSPYGAYESVEQA 31 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 35.5 bits (78), Expect = 1.3 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 14 RQRRGARYPIRPIVSRIT 67 R R GARYPIRPIVSRIT Sbjct: 258 RPRGGARYPIRPIVSRIT 275 >UniRef50_Q9JN59 Cluster: Beta-galactosidase; n=16; Vibrio cholerae|Rep: Beta-galactosidase - Vibrio cholerae Length = 56 Score = 34.3 bits (75), Expect = 2.9 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 82 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 189 +L +DW+NP + + + H P S+R +EAR D Sbjct: 7 ILLSQDWQNPHIVKWHCRTPHVPLHSYRTEQEARLD 42 >UniRef50_Q15XN9 Cluster: Glycoside hydrolase family 2, TIM barrel precursor; n=1; Pseudoalteromonas atlantica T6c|Rep: Glycoside hydrolase family 2, TIM barrel precursor - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 1079 Score = 33.9 bits (74), Expect = 3.9 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 91 RRDWENPGVTQLNRLAAHPPFASWRNSEEART 186 + DWENP V Q+NRL A S+ E+A T Sbjct: 31 KNDWENPDVIQINRLPARATSYSFDTPEQALT 62 >UniRef50_Q5DC94 Cluster: SJCHGC09076 protein; n=1; Schistosoma japonicum|Rep: SJCHGC09076 protein - Schistosoma japonicum (Blood fluke) Length = 109 Score = 33.1 bits (72), Expect = 6.7 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +1 Query: 76 AVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ 201 A L+RR+ +NPG QLN L A P F +++A +R S+ Sbjct: 57 AAFLKRREGKNPGCPQLNPLEALPLFPGGEKTKKAPPNRLSK 98 >UniRef50_A6G4K3 Cluster: Putative uncharacterized protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized protein - Plesiocystis pacifica SIR-1 Length = 531 Score = 32.7 bits (71), Expect = 8.9 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 95 VTGKTLALPNLIALQHIPLSPAGVIAKRPAPIAL 196 V+G L LP+L+ PL P G++A++ PIAL Sbjct: 64 VSGPNLQLPHLVDELATPLPPTGLLARKMDPIAL 97 >UniRef50_Q2WGJ9 Cluster: C8orfK23 protein; n=24; Euteleostomi|Rep: C8orfK23 protein - Homo sapiens (Human) Length = 1857 Score = 32.7 bits (71), Expect = 8.9 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +2 Query: 59 RITIHWP-SFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPN--SCAXEWRMA 229 R+ WP S +TGK A +L+ + +P G K P P+A PN + W M+ Sbjct: 1749 RVRGWWPFSKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMS 1808 Query: 230 NCKR*YFV 253 K Y++ Sbjct: 1809 PFKCLYYL 1816 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 676,997,092 Number of Sequences: 1657284 Number of extensions: 13821279 Number of successful extensions: 33734 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 32704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33727 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -