BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0567.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 2.4 08_01_0657 + 5674907-5674993,5675615-5676583 29 4.2 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 105 AAARCQRERNYRESLLWKARNFGDAHSTPTRSMRTPSCEXLQ 230 A +RC+ R Y + L+ R+ AH+ R++R LQ Sbjct: 13 AVSRCKARRRYTKQLVQARRDMAAAHALYLRALRATGAALLQ 54 >08_01_0657 + 5674907-5674993,5675615-5676583 Length = 351 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 555 AHLRCRCLWASVTTSHQVDYELVHPFKQ 638 A LRCR + S TTS VD + H FK+ Sbjct: 79 AALRCRLISNSATTSAAVDGHVSHAFKR 106 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,204,384 Number of Sequences: 37544 Number of extensions: 282129 Number of successful extensions: 593 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -