BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0567.Seq (648 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73102-15|CAA97416.1| 401|Caenorhabditis elegans Hypothetical p... 42 4e-04 AL132948-23|CAC51049.1| 429|Caenorhabditis elegans Hypothetical... 27 8.7 >Z73102-15|CAA97416.1| 401|Caenorhabditis elegans Hypothetical protein B0035.14 protein. Length = 401 Score = 41.9 bits (94), Expect = 4e-04 Identities = 14/36 (38%), Positives = 28/36 (77%) Frame = +1 Query: 4 NLKVPYYVKENFHSDYQGSLRRLEMSIEEEYLVALR 111 +L+VPY+V+ +F + Y+G +R++E +E++Y+ LR Sbjct: 320 DLRVPYFVRTDFETSYRGRIRQVEQQVEDDYIQNLR 355 >AL132948-23|CAC51049.1| 429|Caenorhabditis elegans Hypothetical protein Y39B6A.31 protein. Length = 429 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 597 KWLLKPIDIYNVNAPPTLRLSSKVSSAQEIFT 502 K LLK +D+ +V PP ++ SK+ S ++ T Sbjct: 261 KGLLKSVDLLSVLKPPVIQTMSKMRSQLKVCT 292 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,316,236 Number of Sequences: 27780 Number of extensions: 228541 Number of successful extensions: 478 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 478 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -