BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0563.Seq (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21750.2 68414.m02723 protein disulfide isomerase, putative s... 79 4e-15 At1g21750.1 68414.m02722 protein disulfide isomerase, putative s... 79 4e-15 At1g77510.1 68414.m09026 protein disulfide isomerase, putative s... 72 4e-13 At1g35620.1 68414.m04425 thioredoxin family protein similar to S... 62 4e-10 At2g47470.2 68415.m05924 thioredoxin family protein similar to p... 60 1e-09 At2g47470.1 68415.m05925 thioredoxin family protein similar to p... 60 1e-09 At5g60640.2 68418.m07611 thioredoxin family protein similar to p... 58 6e-09 At5g60640.1 68418.m07610 thioredoxin family protein similar to p... 58 6e-09 At3g54960.1 68416.m06094 thioredoxin family protein similar to p... 54 8e-08 At2g32920.1 68415.m04036 thioredoxin family protein similar to S... 49 4e-06 At1g04980.1 68414.m00497 thioredoxin family protein similar to S... 48 7e-06 At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa... 44 8e-05 At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa... 44 1e-04 At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t... 41 0.001 At1g07960.3 68414.m00867 thioredoxin family protein low similari... 41 0.001 At1g07960.2 68414.m00866 thioredoxin family protein low similari... 41 0.001 At1g07960.1 68414.m00865 thioredoxin family protein low similari... 41 0.001 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 39 0.003 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 37 0.016 At1g52260.1 68414.m05897 thioredoxin family protein similar to p... 36 0.029 At3g16110.1 68416.m02035 thioredoxin family protein similar to p... 35 0.050 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 35 0.066 At2g01270.1 68415.m00040 thioredoxin family protein low similari... 34 0.087 At3g19780.1 68416.m02504 expressed protein 33 0.15 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 33 0.15 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 33 0.27 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 33 0.27 At3g22360.1 68416.m02823 alternative oxidase 1b, mitochondrial (... 32 0.46 At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa... 31 1.1 At3g27620.1 68416.m03450 alternative oxidase 1c, mitochondrial (... 31 1.1 At5g37950.1 68418.m04571 hypothetical protein 30 1.4 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 30 1.4 At1g08430.1 68414.m00932 expressed protein contains Pfam profile... 30 1.9 At5g61440.1 68418.m07709 thioredoxin family protein low similari... 29 2.5 At4g26160.1 68417.m03765 thioredoxin family protein low similari... 29 2.5 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 29 2.5 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 29 3.3 At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop... 29 3.3 At5g10370.1 68418.m01203 helicase domain-containing protein / IB... 29 4.3 At3g03860.1 68416.m00398 expressed protein 29 4.3 At5g38010.1 68418.m04578 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.7 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 28 5.7 At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P... 28 5.7 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 28 5.7 At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to... 28 5.7 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 28 5.7 At1g08440.1 68414.m00933 hypothetical protein contains Pfam prof... 28 5.7 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 27 10.0 At3g43270.1 68416.m04567 pectinesterase family protein contains ... 27 10.0 At1g61970.1 68414.m06990 mitochondrial transcription termination... 27 10.0 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 27 10.0 >At1g21750.2 68414.m02723 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 487 Score = 78.6 bits (185), Expect = 4e-15 Identities = 38/87 (43%), Positives = 55/87 (63%), Gaps = 2/87 (2%) Frame = +2 Query: 254 VKTDVPPVALAKVDCTEG-GKSTCEQFSVSGYPTLKIFRKG-ELSSEYNGPRESNGIVKY 427 + ++VPPV LAK+D +E + Q+ V G+PT+KIFR G + EYNGPRE+ GIV Y Sbjct: 76 LSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTY 135 Query: 428 MRAQVGPSSKELLTVADFEAFTSKDEV 508 ++ Q GP+S E+ + D S +V Sbjct: 136 LKKQSGPASAEIKSADDASEVVSDKKV 162 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +3 Query: 114 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 +E VL L ++F+ +++HD +V FYAPWCGHCK+L PEY AA Sbjct: 29 KEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQLAPEYEKAA 73 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 132 LTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKP 230 ++DS VL+ L+ FYAPWCGHC++L P Sbjct: 380 VSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 35.1 bits (77), Expect = 0.050 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = +1 Query: 508 MVVGFFEKESDLKGE-FLKTADKLREEVTFAHSSANEVLEK--TGYKNNVV-LYRPKRLQ 675 +VVG F K S + + F+ A+KLR E+ FAH+S ++L + + VV L++P Sbjct: 163 VVVGIFPKLSGSEFDSFMAIAEKLRSELDFAHTSDAKLLPRGESSVTGPVVRLFKP--FD 220 Query: 676 NKFEDSSVAFDGDTEKVSLKAFIK 747 +F DS FDG+ +L+ F+K Sbjct: 221 EQFVDSK-DFDGE----ALEKFVK 239 >At1g21750.1 68414.m02722 protein disulfide isomerase, putative similar to SP|P29828 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform contains non-consensus GA donor splice site at intron 9 Length = 501 Score = 78.6 bits (185), Expect = 4e-15 Identities = 38/87 (43%), Positives = 55/87 (63%), Gaps = 2/87 (2%) Frame = +2 Query: 254 VKTDVPPVALAKVDCTEG-GKSTCEQFSVSGYPTLKIFRKG-ELSSEYNGPRESNGIVKY 427 + ++VPPV LAK+D +E + Q+ V G+PT+KIFR G + EYNGPRE+ GIV Y Sbjct: 76 LSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTY 135 Query: 428 MRAQVGPSSKELLTVADFEAFTSKDEV 508 ++ Q GP+S E+ + D S +V Sbjct: 136 LKKQSGPASAEIKSADDASEVVSDKKV 162 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = +3 Query: 114 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 +E VL L ++F+ +++HD +V FYAPWCGHCK+L PEY AA Sbjct: 29 KEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQLAPEYEKAA 73 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +3 Query: 132 LTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKP 230 ++DS VL+ L+ FYAPWCGHC++L P Sbjct: 380 VSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412 Score = 35.1 bits (77), Expect = 0.050 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = +1 Query: 508 MVVGFFEKESDLKGE-FLKTADKLREEVTFAHSSANEVLEK--TGYKNNVV-LYRPKRLQ 675 +VVG F K S + + F+ A+KLR E+ FAH+S ++L + + VV L++P Sbjct: 163 VVVGIFPKLSGSEFDSFMAIAEKLRSELDFAHTSDAKLLPRGESSVTGPVVRLFKP--FD 220 Query: 676 NKFEDSSVAFDGDTEKVSLKAFIK 747 +F DS FDG+ +L+ F+K Sbjct: 221 EQFVDSK-DFDGE----ALEKFVK 239 >At1g77510.1 68414.m09026 protein disulfide isomerase, putative similar to protein disulfide isomerase precursor GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit: PF00085 Thioredoxins Length = 508 Score = 72.1 bits (169), Expect = 4e-13 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 2/67 (2%) Frame = +2 Query: 269 PPVALAKVDCTE-GGKSTCEQFSVSGYPTLKIFRKGELS-SEYNGPRESNGIVKYMRAQV 442 PP+ALAK+D +E K ++ + G+PTLKI R G S +YNGPRE+ GIV Y++ Q Sbjct: 80 PPLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQS 139 Query: 443 GPSSKEL 463 GP+S E+ Sbjct: 140 GPASVEI 146 Score = 65.7 bits (153), Expect = 3e-11 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Frame = +3 Query: 48 FKMFGSLKFVLLLGIIYLCKAAEED---VLDLTDSDFSAVLSQHDTALVMFYAPWCGHCK 218 FK F +LLL + +EE VL L S+F+ +S+HD +V FYAPWCGHC+ Sbjct: 3 FKGFACFSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQ 62 Query: 219 RLKPEYAVAA 248 +L PEY AA Sbjct: 63 KLAPEYEKAA 72 Score = 38.7 bits (86), Expect = 0.004 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +3 Query: 156 VLSQHDTALVMFYAPWCGHCKRLKP 230 V L+ FYAPWCGHC++L P Sbjct: 386 VFKSGKNVLIEFYAPWCGHCQKLAP 410 >At1g35620.1 68414.m04425 thioredoxin family protein similar to SP|Q43116 Protein disulfide isomerase precursor (PDI) (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 62.1 bits (144), Expect = 4e-10 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = +3 Query: 123 VLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 VL+LTDS+F + +S D V FYAPWCGHCKRL PE AA Sbjct: 34 VLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAA 75 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/59 (27%), Positives = 35/59 (59%) Frame = +2 Query: 272 PVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGP 448 P+ +AK++ + + + + +PTL ++ G + EY GPR+++ +V+Y++ V P Sbjct: 84 PIVIAKLNADKYSR-LARKIEIDAFPTLMLYNHG-VPMEYYGPRKADLLVRYLKKFVAP 140 >At2g47470.2 68415.m05924 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 266 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/55 (49%), Positives = 33/55 (60%) Frame = +3 Query: 72 FVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEY 236 F L + L A +DV+ LTD F + + ALV FYAPWCGHCK+L PEY Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEY 62 Score = 56.8 bits (131), Expect = 1e-08 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELS-SEYNGPRESNGIVKYMRAQVGPS 451 V +AKVDC E KS C ++ VSGYPT++ F KG L +Y GPR + + +Y+ + G + Sbjct: 75 VLIAKVDCDEQ-KSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTN 133 Query: 452 SK 457 K Sbjct: 134 VK 135 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 108 AAEEDVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 A ++V+ LT +F VL Q+ LV FYAPWCGHCK L P Y A Sbjct: 138 AVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVA 185 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 3/68 (4%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRK-GELSSEYNGPRESNGIVKYMRAQVGPS 451 V +A +D + K+ E++ VSG+PTLK F K + +Y+G R+ + V ++ + G S Sbjct: 194 VVIANLDA-DAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS 252 Query: 452 --SKELLT 469 SK LT Sbjct: 253 RDSKGQLT 260 >At2g47470.1 68415.m05925 thioredoxin family protein similar to protein disulfide isomerase [Dictyostelium discoideum] GI:2627440; contains Pfam profile: PF00085 Thioredoxin Length = 361 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/55 (49%), Positives = 33/55 (60%) Frame = +3 Query: 72 FVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEY 236 F L + L A +DV+ LTD F + + ALV FYAPWCGHCK+L PEY Sbjct: 8 FGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEY 62 Score = 56.8 bits (131), Expect = 1e-08 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELS-SEYNGPRESNGIVKYMRAQVGPS 451 V +AKVDC E KS C ++ VSGYPT++ F KG L +Y GPR + + +Y+ + G + Sbjct: 75 VLIAKVDCDEQ-KSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTN 133 Query: 452 SK 457 K Sbjct: 134 VK 135 Score = 51.2 bits (117), Expect = 7e-07 Identities = 24/48 (50%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +3 Query: 108 AAEEDVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 A ++V+ LT +F VL Q+ LV FYAPWCGHCK L P Y A Sbjct: 138 AVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVA 185 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 3/68 (4%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRK-GELSSEYNGPRESNGIVKYMRAQVGPS 451 V +A +D + K+ E++ VSG+PTLK F K + +Y+G R+ + V ++ + G S Sbjct: 194 VVIANLDA-DAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS 252 Query: 452 --SKELLT 469 SK LT Sbjct: 253 RDSKGQLT 260 >At5g60640.2 68418.m07611 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 536 Score = 58.0 bits (134), Expect = 6e-09 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 114 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 E+DV+ + + +F+ V+ + LV FYAPWCGHC+ L PEYA AA Sbjct: 102 EKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Score = 49.2 bits (112), Expect = 3e-06 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGPSS 454 V LAK+D TE + +++ V G+PTL F GE Y G R IV +++ ++GP Sbjct: 154 VVLAKIDATEENE-LAQEYRVQGFPTLLFFVDGE-HKPYTGGRTKETIVTWVKKKIGPGV 211 Query: 455 KELLTVADFE-AFTSKDEVWL 514 L T+ D E TS ++V L Sbjct: 212 YNLTTLDDAEKVLTSGNKVVL 232 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 114 EEDVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEY 236 +EDV + +F VL L+ YAPWCGHC+ L+P Y Sbjct: 440 DEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMY 481 >At5g60640.1 68418.m07610 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 597 Score = 58.0 bits (134), Expect = 6e-09 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +3 Query: 114 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 E+DV+ + + +F+ V+ + LV FYAPWCGHC+ L PEYA AA Sbjct: 102 EKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146 Score = 49.2 bits (112), Expect = 3e-06 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGPSS 454 V LAK+D TE + +++ V G+PTL F GE Y G R IV +++ ++GP Sbjct: 154 VVLAKIDATEENE-LAQEYRVQGFPTLLFFVDGE-HKPYTGGRTKETIVTWVKKKIGPGV 211 Query: 455 KELLTVADFE-AFTSKDEVWL 514 L T+ D E TS ++V L Sbjct: 212 YNLTTLDDAEKVLTSGNKVVL 232 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 114 EEDVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEY 236 +EDV + +F VL L+ YAPWCGHC+ L+P Y Sbjct: 440 DEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMY 481 >At3g54960.1 68416.m06094 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 579 Score = 54.4 bits (125), Expect = 8e-08 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +3 Query: 114 EEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 E+DV LT +F+ + + A+V FYAPWCG C+ L PEYA AA Sbjct: 98 EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAA 142 Score = 54.4 bits (125), Expect = 8e-08 Identities = 25/75 (33%), Positives = 42/75 (56%) Frame = +2 Query: 278 ALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGPSSK 457 ALAK+D TE G +++ + G+PT+ +F GE+ Y G R +GIV +++ + PS Sbjct: 150 ALAKIDATEEG-DLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIH 208 Query: 458 ELLTVADFEAFTSKD 502 + T + E S + Sbjct: 209 NITTKEEAERVLSAE 223 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +3 Query: 120 DVLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKPEY 236 DV + ++F VL + L+ YAPWCGHC+ +P Y Sbjct: 438 DVKVIVGNNFDEIVLDESKDVLLEIYAPWCGHCQSFEPIY 477 >At2g32920.1 68415.m04036 thioredoxin family protein similar to SP|Q15084 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085: Thioredoxin Length = 440 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +3 Query: 123 VLDLTDSDF-SAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAAGL 254 V+ LT S+F S VL+ + LV F+APWCGHCK L P + A + Sbjct: 32 VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANI 76 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +3 Query: 126 LDLTDSDFS-AVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 ++L S+F V+ ++ +V F+APWCGHCK+L PE+ AA Sbjct: 165 VELNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAA 206 Score = 37.9 bits (84), Expect = 0.007 Identities = 14/54 (25%), Positives = 30/54 (55%) Frame = +2 Query: 281 LAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQV 442 +A +D + +S + + + G+PT+K+F G+ +Y G R++ I + Q+ Sbjct: 83 VAAIDA-DAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQI 135 >At1g04980.1 68414.m00497 thioredoxin family protein similar to SP|Q63081 Protein disulfide isomerase A6 precursor (EC 5.3.4.1) {Rattus norvegicus}; contains Pfam profile PF00085: Thioredoxin Length = 443 Score = 48.0 bits (109), Expect = 7e-06 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = +3 Query: 123 VLDLTDSDF-SAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 VL LT S+F S VL+ + LV F+APWCGHC+ L P + A Sbjct: 30 VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVA 72 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/42 (42%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +3 Query: 126 LDLTDSDFSAVLSQH-DTALVMFYAPWCGHCKRLKPEYAVAA 248 ++L S+F ++++ + +V F+APWCGHCK+L PE+ AA Sbjct: 166 VELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAA 207 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/62 (29%), Positives = 34/62 (54%) Frame = +2 Query: 281 LAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVGPSSKE 460 +A +D + KS + + V G+PT+K+F G+ +Y G R++ I ++ Q+ K+ Sbjct: 81 VAAIDA-DAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIKALLKD 139 Query: 461 LL 466 L Sbjct: 140 RL 141 >At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam PF00085: Thioredoxin Length = 480 Score = 44.4 bits (100), Expect = 8e-05 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 9/67 (13%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKG-ELSSE--------YNGPRESNGIVKY 427 V LAKVDCT+ G C + + GYP+++IFRKG +L + Y G R++ +VK Sbjct: 199 VILAKVDCTQEG-DLCRRNHIQGYPSIRIFRKGSDLKDDNAHHDHESYYGDRDTESLVKM 257 Query: 428 MRAQVGP 448 + + V P Sbjct: 258 VVSLVEP 264 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +3 Query: 117 EDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 ED + LT +F Q +V FYAPWC C LKP + AA Sbjct: 141 EDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAA 184 >At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam profile PF00085: Thioredoxin Length = 483 Score = 44.0 bits (99), Expect = 1e-04 Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 9/76 (11%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSE---------YNGPRESNGIVKY 427 V L VDCTE + C++ + GYP+++IFRKG E Y G R+++ IVK Sbjct: 199 VLLGNVDCTEE-PALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKM 257 Query: 428 MRAQVGPSSKELLTVA 475 + V P E VA Sbjct: 258 VEGLVAPIHPETHKVA 273 Score = 35.9 bits (79), Expect = 0.029 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 117 EDVLDLTDSDFSAVLSQHDTALVM-FYAPWCGHCKRLKPEYAVAAGL 254 + + LT + F A LS H LV+ F APWC RLKP + AA + Sbjct: 141 DGAIPLTSASFEA-LSHHFPILVVNFNAPWCYWSNRLKPSWEKAANI 186 >At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to Pfam PF00085: Thioredoxin; contains 2 predicted transmembrane domains Length = 484 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 9/71 (12%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSE---------YNGPRESNGIVKY 427 V L VDCTE + C+ + GYP+++IFR+G E Y G R+++ +VK Sbjct: 200 VLLGSVDCTEE-PTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKM 258 Query: 428 MRAQVGPSSKE 460 + + P KE Sbjct: 259 VEELLKPIKKE 269 Score = 34.3 bits (75), Expect = 0.087 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 126 LDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAAGL*R 260 + LT + F +V FYAPWC RLKP + A+ + R Sbjct: 145 IPLTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKASQITR 189 >At1g07960.3 68414.m00867 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +3 Query: 75 VLLLGI-IYLCKAAEEDVLDLTDSDFSAVLSQHDTA-LVMFYAPWCGHCKRL 224 +LLL I I L KA +V+ LT FS + + DTA V F PWC HCK+L Sbjct: 13 ILLLFIPIELVKA---EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYM 430 + + +VDC ++ C + + YPT +F GE S+Y G R+ + ++ Sbjct: 78 IEVGEVDCGTS-RAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFV 128 >At1g07960.2 68414.m00866 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +3 Query: 75 VLLLGI-IYLCKAAEEDVLDLTDSDFSAVLSQHDTA-LVMFYAPWCGHCKRL 224 +LLL I I L KA +V+ LT FS + + DTA V F PWC HCK+L Sbjct: 13 ILLLFIPIELVKA---EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYM 430 + + +VDC ++ C + + YPT +F GE S+Y G R+ + ++ Sbjct: 78 IEVGEVDCGTS-RAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFV 128 >At1g07960.1 68414.m00865 thioredoxin family protein low similarity to protein disulfide isomerase 4 [Giardia intestinalis] GI:13489047; contains Pfam profile PF00085: Thioredoxin Length = 146 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/52 (48%), Positives = 31/52 (59%), Gaps = 2/52 (3%) Frame = +3 Query: 75 VLLLGI-IYLCKAAEEDVLDLTDSDFSAVLSQHDTA-LVMFYAPWCGHCKRL 224 +LLL I I L KA +V+ LT FS + + DTA V F PWC HCK+L Sbjct: 13 ILLLFIPIELVKA---EVITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 275 VALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYM 430 + + +VDC ++ C + + YPT +F GE S+Y G R+ + ++ Sbjct: 78 IEVGEVDCGTS-RAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFV 128 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 108 AAEEDVLDLTDSDFSAVLSQHDT-ALVMFYAPWCGHCKRLKP 230 AA +V +L+DS++ + + D LV F+APWCG C+ + P Sbjct: 83 AAAVEVPNLSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 36.7 bits (81), Expect = 0.016 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +3 Query: 99 LCKAAEE--DVLDLTDSDF-SAVLSQHDTALVMFYAPWCGHCKRLKP 230 +C+A E D+ + DS + S VL +V F+APWCG CK + P Sbjct: 72 VCEAQETTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118 >At1g52260.1 68414.m05897 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 537 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 111 AEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 A+ VL+L V+ ++ +V+ YAPWC L P +A AA Sbjct: 75 AQRIVLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAA 120 >At3g16110.1 68416.m02035 thioredoxin family protein similar to protein disulfide isomerase GI:5902592 from [Volvox carteri f. nagariensis], GI:2708314 from Chlamydomonas reinhardtii; contains Pfam profile: PF00085 Thioredoxin Length = 534 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 111 AEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPEYAVAA 248 A+ V++L + ++ ++ +V+ YAPWC L P +A AA Sbjct: 73 AQRIVVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAA 118 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 34.7 bits (76), Expect = 0.066 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 87 GIIYLCKAAEEDVLDLTDSDF-SAVLSQHDTALVMFYAPWCGHCKRLKP 230 G+I + + + DS + S VL + V F+APWCG CK + P Sbjct: 64 GVICEAQDTATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDP 112 >At2g01270.1 68415.m00040 thioredoxin family protein low similarity to quiescin [Homo sapiens] GI:13257405; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 495 Score = 34.3 bits (75), Expect = 0.087 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 114 EEDVLDLTDSDFSAVLSQHDT--ALVMFYAPWCGHCKRLKPEYAVAAGL 254 ++ ++L ++F +VL A+V F+A WC C+ KP Y A L Sbjct: 34 KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVARL 82 >At3g19780.1 68416.m02504 expressed protein Length = 1014 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = +3 Query: 66 LKFVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCKRLKPE 233 L F++ + II L + + LT+ +FS+ + H L+ PWCG + LK E Sbjct: 9 LPFLVFVSII-LPSSCHGEWEILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYE 63 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 123 VLDLTDSDFSA-VLSQHDTALVMFYAPWCGHCKRLKP 230 + ++ +S+FS+ VL LV F A WCG CK + P Sbjct: 71 IKEIGESEFSSTVLESAQPVLVEFVATWCGPCKLIYP 107 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 114 EEDVLDLTDSDFSAVLSQHDT--ALVMFYAPWCGHCKRLKPEYAVAAGL 254 +++ ++L ++F +V A++ F+A WC C+ KP Y A L Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARL 88 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 114 EEDVLDLTDSDFSAVLSQHDT--ALVMFYAPWCGHCKRLKPEYAVAAGL 254 +++ ++L ++F +V A++ F+A WC C+ KP Y A L Sbjct: 40 KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVARL 88 >At3g22360.1 68416.m02823 alternative oxidase 1b, mitochondrial (AOX1B) identical to GB:O23913 [SP|O23913] from [Arabidopsis thaliana] Length = 325 Score = 31.9 bits (69), Expect = 0.46 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +2 Query: 605 QPMKFLKKPDTKTMWSCIVP-----SDSRTSLKTHLLPST 709 +PMK K+ T+ WSC P SD LK H +PST Sbjct: 82 KPMKITKEDGTEWKWSCFRPWETYKSDLTIDLKKHHVPST 121 >At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin-like protein (hcf164 gene) GI;12049652 Length = 261 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 129 DLTDS--DFSAVLSQHDTALVMFYAPWCGHCKRLKPE 233 DLT S + LS +V FYA WC C+ L P+ Sbjct: 123 DLTASALPYEEALSNGKPTVVEFYADWCEVCRELAPD 159 >At3g27620.1 68416.m03450 alternative oxidase 1c, mitochondrial (AOX1C) identical to alternative oxidase 1c precursor GB:O22048 [SP|O22048] from [Arabidopsis thaliana] Length = 329 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +2 Query: 605 QPMKFLKKPDTKTMWSCIVP-----SDSRTSLKTHLLPST 709 +PMK K+ T+ WSC P +D LK H +PST Sbjct: 86 KPMKITKEDGTEWKWSCFRPWETYKADLTIDLKKHHVPST 125 >At5g37950.1 68418.m04571 hypothetical protein Length = 351 Score = 30.3 bits (65), Expect = 1.4 Identities = 31/120 (25%), Positives = 48/120 (40%), Gaps = 1/120 (0%) Frame = -2 Query: 567 SCFQELSFQVRFLFEESDNHTSSLEVKASKSATVRSSLELGPTWARMYLTMPLDSLGPLY 388 S F + V + T+S + + S SSLE W + L +P+ +GPLY Sbjct: 160 SAFAPVEASVEVFKSSCEKGTASSMIINTVSCLEISSLE----WLQQELKIPIYPIGPLY 215 Query: 387 SEESSPFLNIFSVGYPDTENCSQVLLPPSVQSTLASATGG-TSVFTGRXLPHTLALVSYN 211 S+P ++ + E+C L S + + G T + T L LVS N Sbjct: 216 MVSSAPPTSLLD----ENESCIDWLNKQKPSSVIYISLGSFTLLETKEVLEMASGLVSSN 271 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 135 TDSDFSAVLSQHDT-ALVMFYAPWCGHCKRLKP 230 T + F +L D LV FYA WCG C+ + P Sbjct: 64 TFNSFDDLLQNSDKPVLVDFYATWCGPCQLMVP 96 >At1g08430.1 68414.m00932 expressed protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 493 Score = 29.9 bits (64), Expect = 1.9 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = +3 Query: 18 VRFC*KAPAKFKMFGSLKFVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALV--MF 191 VRF KF +G L F+L +I L +E+++DL +S S V+ + ++ +F Sbjct: 124 VRFFPWVKTKFD-YGILIFILTFALISLSGFRDEEIMDLAESRLSTVVIGGVSCILISIF 182 Query: 192 YAP-WCG 209 P W G Sbjct: 183 VCPVWAG 189 >At5g61440.1 68418.m07709 thioredoxin family protein low similarity to thioredoxin [Callithrix jacchus] GI:13560979; contains Pfam profile: PF00085 Thioredoxin Length = 245 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +3 Query: 105 KAAEEDVLDLTDSDF--SAVLSQHDTALVM-FYAPWCGHCKRLKPE 233 K+ ++L++ ++ ++L+ D +V+ FY+P CG CK L P+ Sbjct: 81 KSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPK 126 >At4g26160.1 68417.m03765 thioredoxin family protein low similarity to thioredoxin [Ictalurus punctatus] GI:9837585; contains Pfam profile: PF00085 Thioredoxin Length = 221 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/51 (25%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +3 Query: 105 KAAEEDVLDLTDSD--FSAVLSQHDTALVM-FYAPWCGHCKRLKPEYAVAA 248 + A +++D+T ++ +A+ D +++ FY WCG C+ + P+ A Sbjct: 89 RKAGPNMIDITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTA 139 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/64 (28%), Positives = 25/64 (39%) Frame = +3 Query: 39 PAKFKMFGSLKFVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALVMFYAPWCGHCK 218 P + G LKF L E DS +++ LV +YA WCG C+ Sbjct: 38 PVRRVRTGDLKFPSLSSTTRCTPRRIEAKKQTFDSFEDLLVNSDKPVLVDYYATWCGPCQ 97 Query: 219 RLKP 230 + P Sbjct: 98 FMVP 101 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 141 SDFSAVLSQHDTALVMFYAPWCGHCKRLKPE 233 S +A+ + ++ F A WCG CK L+P+ Sbjct: 50 SRLNALKDTNKLLVIEFTAKWCGPCKTLEPK 80 >At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate 5'-adenylylsulfate (APS) sulfotransferase 2 / 3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase homolog 43 (PRH-43) identical to SP|P92981 5'-adenylylsulfate reductase 2, chloroplast precursor (EC 1.8.4.9) (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 2) (APS sulfotransferase 2) (Thioredoxin independent APS reductase 2) (3'-phosphoadenosine-5'-phosphosulfate reductase homolog 43) (PAPS reductase homolog 43) (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS reductase homolog (PRH43) GI:1710115 Length = 454 Score = 29.1 bits (62), Expect = 3.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 180 LVMFYAPWCGHCKRLKPEY 236 LV+ YAPWC C+ ++ Y Sbjct: 366 LVVLYAPWCPFCQAMEASY 384 >At5g10370.1 68418.m01203 helicase domain-containing protein / IBR domain-containing protein / zinc finger protein-related similar to RNA-dependent ATPase/helicase Cdc28p [Schizosaccharomyces pombe] GI:1439562; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, weak hit to PF00097: Zinc finger, C3HC4 type (RING finger), PF01485: IBR domain Length = 1775 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -2 Query: 522 ESDNHTSSLEVKASKSATVRSSLELGPTWARMYLTMPLDSLGPLYSEESSP 370 + +H+SS S+SA L PTW + + P + P Y + +P Sbjct: 19 QQSSHSSSTNRYNSRSAQSSPPLNHRPTWNQQHSQYPNSNFPPNYRRDRNP 69 >At3g03860.1 68416.m00398 expressed protein Length = 300 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 138 DSDFSAVLSQHDTAL--VMFYAPWCGHCKRLKPEYAVAAGL 254 DS + SQH A V+FYA WC + ++P++ + + + Sbjct: 62 DSLDRLMASQHGNAYMSVLFYASWCPFSRAVRPKFDMLSSM 102 >At5g38010.1 68418.m04578 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 28.3 bits (60), Expect = 5.7 Identities = 30/120 (25%), Positives = 47/120 (39%), Gaps = 1/120 (0%) Frame = -2 Query: 567 SCFQELSFQVRFLFEESDNHTSSLEVKASKSATVRSSLELGPTWARMYLTMPLDSLGPLY 388 S F + V D T+S + + SSLE W + L +P+ +GPL+ Sbjct: 188 SAFAPVEASVEVFKSSCDKGTASAMIINTVRCLEISSLE----WLQQELKIPIYPIGPLH 243 Query: 387 SEESSPFLNIFSVGYPDTENCSQVLLPPSVQSTLASATGG-TSVFTGRXLPHTLALVSYN 211 S+P ++ + E+C L S + + G T + T L LVS N Sbjct: 244 MVSSAPPTSLLD----ENESCIDWLNKQKPSSVIYISLGSFTLLETKEVLEMASGLVSSN 299 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 138 DSDFSAVLSQHDTALVM-FYAPWCGHCKRLKPEY 236 D+ + V + D +V+ Y WCG CK + P+Y Sbjct: 86 DTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKY 119 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = +2 Query: 287 KVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNGPRESNGIVKYMRAQVG 445 K+DC + K ++ + PT KI + ++ E G + + + A+ G Sbjct: 133 KLDCNQDNKPLAKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAARSG 185 >At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS reductase homolog (PRH19) identical to 5'-adenylylsulfate reductase [Arabidopsis thaliana] GI:2738756; identical to cDNA PAPS reductase homolog (PRH19) GI:1710111 Length = 465 Score = 28.3 bits (60), Expect = 5.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 180 LVMFYAPWCGHCKRLKPEY 236 +V+ YAPWC C+ ++ Y Sbjct: 377 IVVLYAPWCPFCQAMEASY 395 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 28.3 bits (60), Expect = 5.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 153 AVLSQHDTALVMFYAPWCGHCK 218 +VL LV FY WCG C+ Sbjct: 79 SVLKSETPVLVEFYTSWCGPCR 100 >At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 585 Score = 28.3 bits (60), Expect = 5.7 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 4/85 (4%) Frame = +2 Query: 236 CGSXRPVKTDVPPVALAKVDCTEGGKSTCEQFSVSGYPTLKIFRKGELSSEYNG----PR 403 CGS P+ T + + A V C G S+ S+S P+ KG+ E G PR Sbjct: 243 CGS--PLTTILKVLLAASVKCCSSGSSSNAVASMSVSPSNHCVSKGKKEVESQGELEKPR 300 Query: 404 ESNGIVKYMRAQVGPSSKELLTVAD 478 + + RAQ+ S K L AD Sbjct: 301 QEEALPP--RAQLTNSLKVLNGAAD 323 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 162 SQHDTALVMFYAPWCGHCKRLKP 230 SQ +VMF A WCG C+ + P Sbjct: 225 SQTPHVMVMFTARWCGPCRDMIP 247 >At1g08440.1 68414.m00933 hypothetical protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 501 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = +3 Query: 18 VRFC*KAPAKFKMFGSLKFVLLLGIIYLCKAAEEDVLDLTDSDFSAVLSQHDTALV--MF 191 VRF + A++ +G L F+L +I + E+++LDL S V+ + ++ +F Sbjct: 121 VRFFPRVKARYD-YGVLIFILTFALISVSGFREDEILDLAHKRLSTVIMGGVSCVLISIF 179 Query: 192 YAP-WCG 209 P W G Sbjct: 180 VCPVWAG 186 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 27.5 bits (58), Expect = 10.0 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 147 FSAVLSQHDTALVMFYAPWCGHCKRLKP 230 F+ + + +V F A WCG C+ ++P Sbjct: 40 FNEIKESNKLLVVDFSASWCGPCRMIEP 67 >At3g43270.1 68416.m04567 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 527 Score = 27.5 bits (58), Expect = 10.0 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +3 Query: 42 AKFKMFGSLKFVLLLGIIYLCKAAEE 119 AKF+ GS F L L II LC A +E Sbjct: 2 AKFRQMGSSIFFLFLIIISLCSAHKE 27 >At1g61970.1 68414.m06990 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 418 Score = 27.5 bits (58), Expect = 10.0 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +1 Query: 508 MVVGFFEKESDLKGEFLKTADKLREEVTFAHSSANEVLEKTGYKNNVVLY 657 +++ EK K +FL++ E+T SS E+L K G+K V Y Sbjct: 111 LLIADAEKSLGPKLQFLQSRGASSSEITEIVSSVPEILGKKGHKTISVYY 160 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 27.5 bits (58), Expect = 10.0 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 147 FSAVLSQHDTALVMFYAPWCGHCKRLKP 230 F ++ + ++ F A WCG CK ++P Sbjct: 36 FDSMKGSNKLLVIDFTAVWCGPCKAMEP 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,178,726 Number of Sequences: 28952 Number of extensions: 337728 Number of successful extensions: 1106 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1097 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -