BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0562.Seq (697 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosacch... 27 2.6 SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Ma... 26 5.9 >SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2176 Score = 27.1 bits (57), Expect = 2.6 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Frame = +2 Query: 383 ELDEIEYALPAIDAPTLAE----VL--CVSEEEEIKNVQNKEEPVS 502 E DE E A+ A++ +AE VL +S+EEE KN++N + V+ Sbjct: 236 EADEEEEAVEAMEEDEVAEDEDVVLETSISQEEEKKNIENPDTEVT 281 >SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 25.8 bits (54), Expect = 5.9 Identities = 16/60 (26%), Positives = 27/60 (45%) Frame = +2 Query: 386 LDEIEYALPAIDAPTLAEVLCVSEEEEIKNVQNKEEPVSCSHYRLIFYKQSPNNLYKHRR 565 L++ + A I +P+ S Q KE+ S H L +Y+QSP+ + + R Sbjct: 309 LNDYQAAQSNISSPSSRFPTPYSPSVPFGTYQEKEKSYSQDHAELSYYQQSPSMMPPYDR 368 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,474,649 Number of Sequences: 5004 Number of extensions: 44075 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -