BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0559.Seq (812 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2039| Best HMM Match : DUF164 (HMM E-Value=1.2) 30 2.6 SB_382| Best HMM Match : Extensin_2 (HMM E-Value=0.61) 30 2.6 >SB_2039| Best HMM Match : DUF164 (HMM E-Value=1.2) Length = 248 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 499 YKNN*ELVFNIQNSSEMDRVNFVKIKTHSEIMK-INKSHSLTHGE 368 +K+N +L I+N+ D F KTHS+I K I KS TH + Sbjct: 106 HKSNSKLHLQIENTFAKDENTFANSKTHSQIQKHIRKSK--THSQ 148 >SB_382| Best HMM Match : Extensin_2 (HMM E-Value=0.61) Length = 314 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +2 Query: 125 KFFVNISSIDFTQALHYESLNYINDMLFIVYK*NSLILF*LVNN-*HCTLQVCRSTNSEV 301 K F ++ D +SL+Y +D++ IV S ILF + NN C LQ S +++ Sbjct: 186 KHFSRAAASDDLVRSRIDSLSYSDDLITIVKADASRILFKVNNNSPQCNLQCVLSMDTKT 245 Query: 302 FSHL 313 F+ L Sbjct: 246 FTSL 249 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,093,745 Number of Sequences: 59808 Number of extensions: 416486 Number of successful extensions: 656 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -