BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0559.Seq (812 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23139-2|AAL02483.1| 460|Caenorhabditis elegans Hypothetical pr... 29 5.2 >U23139-2|AAL02483.1| 460|Caenorhabditis elegans Hypothetical protein F13H8.11 protein. Length = 460 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 Query: 433 VKIKTHSEIMKINKSHSLTHGEPGPDRHTCTCLYSLNR*E 314 + +K HS+ K++K +H R TC+C++ LN E Sbjct: 235 INVKIHSQAHKLSKFCEFSH------RKTCSCIFELNEKE 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,081,638 Number of Sequences: 27780 Number of extensions: 325306 Number of successful extensions: 575 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1998381620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -