BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0556.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 25 0.52 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.5 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 25.4 bits (53), Expect = 0.52 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 Query: 241 QHSCRSFRGGTNKNSRCRYGY*KDRCTADS 152 Q C + G N+ C Y KD C DS Sbjct: 320 QVECYKYYGNIMVNAMCAYAKGKDACQMDS 349 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/17 (47%), Positives = 10/17 (58%), Gaps = 2/17 (11%) Frame = +3 Query: 393 EVHLF--CQTCDYDGCN 437 E H F C CD+D C+ Sbjct: 740 EAHCFALCHCCDFDACD 756 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/42 (21%), Positives = 22/42 (52%) Frame = -2 Query: 571 IFIFKVLFETKFNMYGGDNELIYFNKRRLRGASNRAIVLPMV 446 +++ + E++F MY + + NK+ + S +LP++ Sbjct: 731 LYLHRARSESEFEMYHQQLQGVAKNKKNVGSMSRNKALLPVI 772 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -1 Query: 98 ARSKTGTRNDSFAIMMHNKL 39 A + G RN MHNKL Sbjct: 347 AADRPGLRNTELVERMHNKL 366 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,220 Number of Sequences: 438 Number of extensions: 2605 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -