SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesV0555.Seq
         (420 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    21   6.4  
AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    21   6.4  

>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 20.6 bits (41), Expect = 6.4
 Identities = 16/47 (34%), Positives = 20/47 (42%)
 Frame = +2

Query: 47  SCSRLDSSLRA*HPGDMHQVIXEIQHXTDNGWFATHLSDILYHCGXL 187
           S  +L  SLR     +   +I E      N WF  H SD L +C  L
Sbjct: 164 SLLQLIKSLRQSSSLEHCTLIGEDNISAKNPWFPRHASD-LDNCNHL 209


>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 20.6 bits (41), Expect = 6.4
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = +3

Query: 42  FPHALGWIVLYGH 80
           F    GW +L+GH
Sbjct: 151 FNRIFGWNILFGH 163


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 76,903
Number of Sequences: 336
Number of extensions: 1156
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  9279512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -