BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0555.Seq (420 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 6.4 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 6.4 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 20.6 bits (41), Expect = 6.4 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 47 SCSRLDSSLRA*HPGDMHQVIXEIQHXTDNGWFATHLSDILYHCGXL 187 S +L SLR + +I E N WF H SD L +C L Sbjct: 164 SLLQLIKSLRQSSSLEHCTLIGEDNISAKNPWFPRHASD-LDNCNHL 209 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 20.6 bits (41), Expect = 6.4 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +3 Query: 42 FPHALGWIVLYGH 80 F GW +L+GH Sbjct: 151 FNRIFGWNILFGH 163 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,903 Number of Sequences: 336 Number of extensions: 1156 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9279512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -