BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0554.Seq (748 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IPJ1 Cluster: CG17377-PC, isoform C; n=6; melanogaste... 66 9e-10 >UniRef50_Q8IPJ1 Cluster: CG17377-PC, isoform C; n=6; melanogaster subgroup|Rep: CG17377-PC, isoform C - Drosophila melanogaster (Fruit fly) Length = 287 Score = 66.1 bits (154), Expect = 9e-10 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = +3 Query: 510 KSRELRGGIMYYSCHCIKRNGLQHDCRRTGCSGEPTCLALPDPYAHP 650 +SRELR GIMY +C C+KRNGLQ C R+ C G P CL P P P Sbjct: 14 RSRELRCGIMYTTCDCVKRNGLQDKCPRSACQGRPACLCFPFPTCGP 60 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 703,300,670 Number of Sequences: 1657284 Number of extensions: 13276932 Number of successful extensions: 32293 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 31121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32269 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61323318355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -