BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0552.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.8 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 4.2 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 7.3 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 7.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 224 YLPQPTSP*LCTKVVGG 274 YLP+ P LCT +V G Sbjct: 1417 YLPEDIDPDLCTHIVYG 1433 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 224 YLPQPTSP*LCTKVVGG 274 YLP P LCT +V G Sbjct: 1842 YLPSDIDPDLCTHIVYG 1858 Score = 22.2 bits (45), Expect = 4.2 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 Query: 615 YNSDATTFVHCSW 577 Y D T ++HC W Sbjct: 1287 YPGDCTRYLHCLW 1299 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +1 Query: 487 TCPLETKQSRLVGPNCPGIIAPEKCKIGXMP 579 TC E ++ CP + P+ K+ +P Sbjct: 695 TCFCENGNNKCFTMECPQVTCPDNMKLEKVP 725 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/32 (25%), Positives = 16/32 (50%) Frame = +3 Query: 30 FPFRRFTFNNSTMAMPVRVLSKFKDGLKLGNV 125 FP+R + + PV ++ K DG+ + + Sbjct: 216 FPYRGVMIDTARNFFPVDLIRKVVDGMAMAKL 247 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 321 NTGLPRCSVPAFFGD 277 NT + +C++P+F D Sbjct: 138 NTAVLKCNIPSFVAD 152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,438 Number of Sequences: 336 Number of extensions: 3592 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -