BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0551.Seq (826 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 29 0.045 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 22 6.8 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 22 6.8 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 9.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 9.0 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.0 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 9.0 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.0 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 29.1 bits (62), Expect = 0.045 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +2 Query: 629 LRTIIYQVLQGLAHMHRHGFFHRV*NRKICLCCGPGLVKIADLGSAREV 775 L +I QV G+ H+ + HR + L C VK++D G +R+V Sbjct: 594 LLSIARQVALGMEHLAKTRVVHRDLAARNVLVCENHTVKVSDFGLSRDV 642 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/36 (25%), Positives = 15/36 (41%) Frame = +2 Query: 653 LQGLAHMHRHGFFHRV*NRKICLCCGPGLVKIADLG 760 + + H H H H + + + GP L +A G Sbjct: 356 ISSMGHSHAHPMHHDMLPETMHMGMGPSLTPLASPG 391 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/36 (25%), Positives = 15/36 (41%) Frame = +2 Query: 653 LQGLAHMHRHGFFHRV*NRKICLCCGPGLVKIADLG 760 + + H H H H + + + GP L +A G Sbjct: 356 ISSMGHSHAHPMHHDMLPETMHMGMGPSLTPLASPG 391 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 Query: 345 LQQLGDGTYGSVVLAQ 392 LQ++ DG YGSVV+ Q Sbjct: 249 LQKM-DGLYGSVVIRQ 263 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +3 Query: 345 LQQLGDGTYGSVVLAQ 392 LQ++ DG YGSVV+ Q Sbjct: 249 LQKM-DGLYGSVVIRQ 263 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 625 RFWECTIGIP 596 RFWEC IP Sbjct: 25 RFWECLAPIP 34 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +1 Query: 577 KSVPADTGCRSCIPRTGAENHHIP 648 + +P D R PR G+ H P Sbjct: 189 RPLPLDQKARDLSPRNGSPTDHSP 212 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 625 RFWECTIGIP 596 RFWEC IP Sbjct: 25 RFWECLAPIP 34 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,992 Number of Sequences: 336 Number of extensions: 4240 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22621642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -