BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0548.Seq (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-tran... 27 0.79 AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 24 4.2 AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 24 4.2 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 24 4.2 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 9.7 >AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 26.6 bits (56), Expect = 0.79 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Frame = -1 Query: 653 AGEKETS*DDQCSSEAV-----VKISKSESAERYGYNHRESDAPPHEEPDGVG*AVEGLA 489 AG + T D C S + + +SE +G+ R P +EE +G G A E LA Sbjct: 154 AGSRMTIADLSCISSVASMVGFIPMERSEFPRVHGWIERMKQLPYYEEINGAG-ATE-LA 211 Query: 488 EAVID 474 E ++D Sbjct: 212 EFIVD 216 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 24.2 bits (50), Expect = 4.2 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Frame = -1 Query: 653 AGEKETS*DDQCSSEAV-----VKISKSESAERYGYNHRESDAPPHEEPDGVG*AVEGLA 489 AG + T D C S + + +SE +G+ R P +EE +G G A E LA Sbjct: 154 AGSRLTIADLSCISSVASMVGFIPMERSEFPRVHGWMERLKQLPYYEEINGAG-ATE-LA 211 Query: 488 EAVID 474 E +++ Sbjct: 212 EFIVN 216 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 24.2 bits (50), Expect = 4.2 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = -1 Query: 650 GEKETS*DDQCSSE-----AVVKISKSESAERYGYNHRESDAPPHEEPDGVG*AVEGLAE 486 GE T D C S VV + +S+ + + R + P +EE +G G A+E LAE Sbjct: 154 GESLTIADFSCISSIATLVGVVPLDESKFPKSTAWMRRMQELPYYEEANGTG-ALE-LAE 211 Query: 485 AVIDSR 468 V+ + Sbjct: 212 FVLGKK 217 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 24.2 bits (50), Expect = 4.2 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = -1 Query: 650 GEKETS*DDQCSSE-----AVVKISKSESAERYGYNHRESDAPPHEEPDGVG*AVEGLAE 486 GE T D C S VV + +S+ + + R + P +EE +G G A+E LAE Sbjct: 154 GESLTIADFSCISSIATLVGVVPLDESKFPKSTAWMRRMQELPYYEEANGTG-ALE-LAE 211 Query: 485 AVIDSR 468 V+ + Sbjct: 212 FVLGKK 217 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.0 bits (47), Expect = 9.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 711 DVLRIVSKIFPTRSRLEAICRR 646 D+LR++ P RS E ICRR Sbjct: 1109 DMLRVLELRDPIRSIDEMICRR 1130 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,363 Number of Sequences: 2352 Number of extensions: 12035 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -