BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0548.Seq (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / hea... 29 3.2 At5g56030.1 68418.m06991 heat shock protein 81-2 (HSP81-2) nearl... 29 4.2 At5g56010.1 68418.m06989 heat shock protein, putative strong sim... 29 4.2 At5g56000.1 68418.m06988 heat shock protein 81-4 (HSP81-4) nearl... 29 4.2 At2g45900.1 68415.m05708 expressed protein 28 5.5 At3g62310.1 68416.m07000 RNA helicase, putative similar to SP|P5... 27 9.6 At3g46980.1 68416.m05101 transporter-related low similarity to b... 27 9.6 >At5g52640.1 68418.m06535 heat shock protein 81-1 (HSP81-1) / heat shock protein 83 (HSP83) nearly identical to SP|P27323 Heat shock protein 81-1 (HSP81-1) (Heat shock protein 83) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 705 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 386 KEEKQKKRNSLSSTWSDNVIQKDFYVPGEVKFSA 285 KEE SL++ W D++ K F V G+++F A Sbjct: 283 KEEYAAFYKSLTNDWEDHLAVKHFSVEGQLEFKA 316 >At5g56030.1 68418.m06991 heat shock protein 81-2 (HSP81-2) nearly identical to SP|P55737 Heat shock protein 81-2 (HSP81-2) {Arabidopsis thaliana} Length = 699 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 386 KEEKQKKRNSLSSTWSDNVIQKDFYVPGEVKFSA 285 KEE SLS+ W +++ K F V G+++F A Sbjct: 277 KEEYAAFYKSLSNDWEEHLAVKHFSVEGQLEFKA 310 >At5g56010.1 68418.m06989 heat shock protein, putative strong similarity to SP|P55737 Heat shock protein 81-2 (HSP81-2) {Arabidopsis thaliana}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 699 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 386 KEEKQKKRNSLSSTWSDNVIQKDFYVPGEVKFSA 285 KEE SLS+ W +++ K F V G+++F A Sbjct: 277 KEEYAAFYKSLSNDWEEHLAVKHFSVEGQLEFKA 310 >At5g56000.1 68418.m06988 heat shock protein 81-4 (HSP81-4) nearly identical to heat shock protein hsp81.4 [Arabidopsis thaliana] GI:1906828; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF00183: Hsp90 protein Length = 699 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -1 Query: 386 KEEKQKKRNSLSSTWSDNVIQKDFYVPGEVKFSA 285 KEE SLS+ W +++ K F V G+++F A Sbjct: 277 KEEYAAFYKSLSNDWEEHLAVKHFSVEGQLEFKA 310 >At2g45900.1 68415.m05708 expressed protein Length = 720 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -1 Query: 389 MKEEKQKKRNSLSSTWSDNVIQKDFYV 309 M+EE+Q +SLS S ++IQ+D Y+ Sbjct: 426 MEEEEQTVMDSLSEAISSSIIQQDAYI 452 >At3g62310.1 68416.m07000 RNA helicase, putative similar to SP|P53131 Pre-mRNA splicing factor RNA helicase PRP43 (Helicase JA1) {Saccharomyces cerevisiae}; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 726 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -2 Query: 649 ERKKLLEMINAAAKLLSKSVSQRVQKGMDITIGK 548 +R+K L ++ + SVS+RV + MD+TIG+ Sbjct: 109 KRRKWLVGCTQPRRVAAMSVSRRVAEEMDVTIGE 142 >At3g46980.1 68416.m05101 transporter-related low similarity to brain specific Na+-dependent inorganic phosphate cotransporter from [Rattus norvegicus] GI:507415, [Homo sapiens] GI:7328925, vesicular glutamate transporter 3 from [Rattus norvegicus] GI:21685382; contains Pfam profile PF00083: major facilitator superfamily protein Length = 533 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -2 Query: 232 LMLNVEFYNCSIFFWNFYSIGKKINFDS 149 ++L Y S F+N Y+ G++++FD+ Sbjct: 504 ILLTAILYLLSALFYNIYATGERVDFDT 531 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,081,911 Number of Sequences: 28952 Number of extensions: 239434 Number of successful extensions: 587 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -