BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0545.Seq (704 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0643 + 12590928-12592172,12592609-12592698 29 3.6 02_02_0651 - 12649275-12649373,12649418-12650479 29 4.8 01_06_1546 + 38147846-38147853,38148413-38148986,38149160-38150011 29 4.8 >02_02_0643 + 12590928-12592172,12592609-12592698 Length = 444 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 229 NVLHFRPGL*RWLTSMTLWTEGFR 300 N++ +RPG+ W+ M W GF+ Sbjct: 165 NIMFWRPGMSDWVPQMLKWDSGFK 188 >02_02_0651 - 12649275-12649373,12649418-12650479 Length = 386 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 229 NVLHFRPGL*RWLTSMTLWTEGFR 300 N++ +RPG+ W+ M W GF+ Sbjct: 165 NIMFWRPGMSDWVPPMLKWDSGFK 188 >01_06_1546 + 38147846-38147853,38148413-38148986,38149160-38150011 Length = 477 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +3 Query: 432 DLPVNPHSVGQLQFPWQWNLILVRRHRSIRLTPKTRGVTFLITSTFGC 575 +L V+P + L IL+RRHR K +G ++ITS GC Sbjct: 314 ELHVSPLTKDYLNITVAMRRILIRRHREAPAVFKLQGTYYMITS--GC 359 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,957,602 Number of Sequences: 37544 Number of extensions: 371996 Number of successful extensions: 889 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -