BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0545.Seq (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) 31 1.2 SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07) Length = 1105 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -2 Query: 625 SKRKEMISKLWRAAASIHPNVLVIRKVTPRVFGVRRMDLCLRTSIR 488 S RK MISK W+ + H + + VTP + RR+ + L+ I+ Sbjct: 303 SSRKTMISKAWQVSGVYH--ITLDANVTPVIHPPRRVAISLKDDIK 346 >SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2286 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 357 DGCGLLNAQSRQYIQNYGPSES-FRPQGHARQPALQP 250 DG GLL ++R++++ Y P+ S +P P QP Sbjct: 1602 DGSGLLTLRNRRFLRAYTPASSDIKPPPAVATPPHQP 1638 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,992,911 Number of Sequences: 59808 Number of extensions: 444262 Number of successful extensions: 1047 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1046 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -