BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0543.Seq (698 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-3548|AAF56297.2| 345|Drosophila melanogaster CG17780-P... 29 4.6 >AE014297-3548|AAF56297.2| 345|Drosophila melanogaster CG17780-PB, isoform B protein. Length = 345 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = -2 Query: 394 GFLFVCFKFIFTKV*VFYLSIEALRSLPG--QLVINKKINSSLKF 266 G LF K IF + + IE R G Q+++N INS LKF Sbjct: 177 GMLFKMLKLIFRRAKRYLDIIETTRIFVGIFQVIVNTYINSPLKF 221 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,446,255 Number of Sequences: 53049 Number of extensions: 454320 Number of successful extensions: 670 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -