BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0543.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin prot... 22 4.9 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 8.5 >AB073997-1|BAC76401.1| 124|Apis mellifera preprotachykinin protein. Length = 124 Score = 22.2 bits (45), Expect = 4.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 369 NLKQTKRNPSDGGHIKGKTKLLFLFNSEHFHIIQ 470 N+ KR P+ ++GK K NSE+F I + Sbjct: 23 NVLFDKRAPTGHQEMQGKEKNSASLNSENFGIFK 56 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 409 CPPSDGFLFVCFKFI 365 CP SD LFV F+ Sbjct: 383 CPESDSILFVSSPFL 397 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,594 Number of Sequences: 438 Number of extensions: 3386 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -