BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0543.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18193.1 68415.m02117 AAA-type ATPase family protein contains... 31 0.73 At5g41505.1 68418.m05040 hypothetical protein 29 3.9 >At2g18193.1 68415.m02117 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 495 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -2 Query: 307 QLVINKKINSSLKFSYITRIMLESKEIRRN 218 +L KK+ + SY+T ++ ES+EI+RN Sbjct: 143 ELTFEKKLRDKVLNSYLTHVVAESEEIKRN 172 >At5g41505.1 68418.m05040 hypothetical protein Length = 245 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = -2 Query: 673 NWEVSFETSCIFVNHMPL----HLDIQC 602 NW+++ +TSC+F H PL HL QC Sbjct: 112 NWKLNVDTSCVFCKH-PLETREHLFFQC 138 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,545,688 Number of Sequences: 28952 Number of extensions: 225439 Number of successful extensions: 427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -